TFF1 Human

Trefoil Factor-1 Human Recombinant
Cat. No.
BT22925
Source
Escherichia Coli.
Synonyms
TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.

Product Specs

Introduction
The Trefoil Factor peptides (TFF1, TFF2, and TFF3) are stable secretory proteins found in the gastrointestinal tract, particularly the gastric mucosa. They play a crucial role in protecting and repairing the intestinal mucosal lining. TFF1 is vital for the proper development of the antral and pyloric gastric mucosa and acts as a tumor suppressor gene specific to the stomach. It stabilizes the mucous layer covering the gastrointestinal mucosa, creating a protective barrier against harmful substances. TFF1 safeguards the mucosa from damage, promotes mucus layer stability, and aids in epithelial healing. It is frequently found in tumors and interacts with the cell membrane of MCF-7 cells. Elevated levels of TFF1 and TFF2 are present in the serum of individuals with inflammatory bowel disease.
Description
Recombinant Human TFF-1, produced in E. coli, is a non-glycosylated polypeptide chain arranged as a homodimer. Each chain comprises 60 amino acids, including a 40 amino acid trefoil motif with three conserved intramolecular disulfide bonds. The total molecular mass of the protein is 13.2 kDa. The purification process of Recombinant Human TFF-1 involves proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The lyophilization of the Human TFF1 protein was carried out from a 0.2µm filtered solution concentrated in 20mM PB, at a pH of 7.4, and 150mM NaCl.
Solubility
To reconstitute the lyophilized TFF1, it is recommended to dissolve it in sterile 18MΩ-cm H2O at a concentration of at least 100µg/ml. This solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized TFF1 remains stable at room temperature for up to 3 weeks. However, for extended storage, it is advisable to store it in a desiccated state below -18°C. After reconstitution, TFF1 should be stored at 4°C for a period of 2-7 days. For long-term storage, freezing below -18°C is recommended. To preserve protein stability during storage, consider adding a carrier protein such as 0.1% HSA or BSA. It's important to avoid repeated freeze-thaw cycles.
Purity
The purity of the protein is greater than 97.0%, as determined by:
(a) Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) analysis.
(b) Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE) analysis.
Biological Activity
The ED50, determined by a chemotaxis bioassay using human MCF-7 cells, is less than 10µg/ml. This corresponds to a specific activity of greater than 100 IU/mg.
Synonyms
TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Source
Escherichia Coli.
Amino Acid Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF.

Product Science Overview

Structure and Function

TFF1 is a 7 kDa peptide that is primarily expressed in the epithelial cells of the stomach and the intestinal mucosa . It forms a homodimer via a disulfide linkage, which is essential for its biological activity . The protein is known for its role in mucosal repair and wound healing. It mediates these processes by stimulating cell migration, inhibiting apoptosis, and promoting the barrier function of mucus .

Expression and Production

Recombinant human TFF1 (rTFF1) has been successfully expressed in various host systems, including Escherichia coli and Brevibacillus choshinensis . The expression levels and bioactivity of rTFF1 can vary depending on the host system used. For instance, rTFF1 produced by B. choshinensis has shown better wound healing capabilities compared to that produced by E. coli .

Biological Significance

TFF1 plays a significant role in the gastric mucosal defense system. It is involved in protecting the gastric mucosa from damage caused by various factors, including stomach acid and digestive enzymes . TFF1 is also considered a tumor suppressor gene in the gastric mucosa, and its down-regulation is associated with the progression of gastric cancer .

Clinical Applications

Due to its role in mucosal protection and repair, rTFF1 has potential therapeutic applications in treating gastric damage and wound healing . The recombinant form of TFF1 can be used to develop treatments for conditions such as gastritis, gastric ulcers, and other gastrointestinal disorders.

Storage and Stability

Recombinant TFF1 is typically provided as a lyophilized powder and should be stored at -20°C to -80°C for long-term stability . Reconstituted protein solutions can be stored at 4-8°C for short-term use .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

TFF2 Human
Trefoil Factor-2 Human Recombinant
Cat. No.
BT23112
Source
Escherichia Coli.
TFF2 Human, His
Trefoil Factor-2 Human Recombinant, His Tag
Cat. No.
BT23199
Source
Escherichia Coli.
TFF3 Human
Trefoil Factor-3 Human Recombinant
Cat. No.
BT23285
Source
Escherichia Coli.
TFF3 Human, His
Trefoil Factor-3 Human Recombinant, His Tag
Cat. No.
BT23351
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.