Introduction
Oncostatin M, a cytokine belonging to the same family as leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6, is encoded by a gene that regulates growth and inhibits the proliferation of various tumor cell lines. It influences the production of cytokines like IL-6, G-CSF, and GM-CSF from endothelial cells.
Description
Recombinant Human Oncostatin-M (209 a.a.), produced in E.Coli, is a single, non-glycosylated polypeptide chain composed of 209 amino acids. With a molecular weight of 23.9kDa, this purified protein is obtained through proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
Oncostatin-M (209 a.a.) was lyophilized from a concentrated solution (1mg/ml) in 1x PBS pH-7.4.
Solubility
To reconstitute the lyophilized Oncostatin-M (209 a.a.), it is recommended to dissolve it in sterile 18MΩ-cm H2O to a concentration not less than 100µg/ml. This solution can then be further diluted in other aqueous solutions.
Stability
Lyophilized Oncostatin-M (209 a.a.) remains stable at room temperature for up to 3 weeks. However, for long-term storage, it should be kept desiccated below -18°C. Once reconstituted, Oncostatin-M (209 a.a.) should be stored at 4°C for 2-7 days and frozen below -18°C for future use. Adding a carrier protein (0.1% HSA or BSA) is recommended for extended storage. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 97.0% as determined by (a) RP-HPLC analysis and (b) SDS-PAGE analysis.
Biological Activity
The ED50, determined by the dose-dependent stimulation of Human TF-1 cells, is less than 2 ng/ml, which translates to a Specific Activity of 500,000 IU/mg.
Synonyms
OSM, MGC20461, Oncostatin M.
Amino Acid Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG
AFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDL
EKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQ
RKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.