HBsAg preS1

Hepatitis B Surface Antigen, preS1 Recombinant
Cat. No.
BT8158
Source
Escherichia Coli.
Synonyms
Appearance
Purity

Greater than 97.0% as determined by:

(a) Analysis by RP-HPLC.

(b) Analysis by SDS-PAGE.

Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.

Product Specs

Introduction
Hepatitis B virus (HBV) can cause serious liver disease in humans. The surface antigens of HBV (HBsAg) consist of three proteins: large (LHBs), middle (MHBs), and small (SHBs or major), all of which share a common carboxyl terminus. The LHBs and MHBs proteins both possess a hydrophobic, repetitive S domain that spans the membrane. Additionally, LHBs contains a unique 119 amino acid region known as preS1.
Description
Recombinant Hepatitis B Surface Antigen preS1, derived from E. coli, is a non-glycosylated polypeptide chain consisting of 119 amino acids. It has a molecular weight of 12.6 kDa.
Purity
Purity exceeds 97.0% as determined by: - RP-HPLC analysis - SDS-PAGE analysis
Formulation
HBsAg protein solution (1 mg/ml) was sterile filtered at 0.2 µm and lyophilized in 20mM PB (pH 7.4) and 50mM NaCl.
Solubility
Before opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the lyophilized protein in sterile distilled water or an aqueous buffer containing 0.1% BSA to a final concentration of 0.1-1.0 mg/mL. Divide the stock solution into smaller working aliquots and store them at -20°C. For further dilutions, use appropriate buffered solutions.
Stability
Lyophilized HBsAg remains stable at 2-8°C. For long-term storage, keep it desiccated at -20°C. After reconstitution, the solution is stable for up to one week at 2-8°C. To maximize stability, aliquot the reconstituted protein into working volumes and store them at -20°C to -70°C. Avoid repeated freeze-thaw cycles.
Source
Escherichia Coli.
Amino Acid Sequence
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGAN
SNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSP
QAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.
Purification Method
HBsAg protein was purified by proprietary chromatographic technique.

Product Science Overview

Introduction

Hepatitis B virus (HBV) is a significant global health concern, causing a spectrum of liver diseases, including chronic infections that can lead to life-threatening conditions such as hepatocellular carcinoma (HCC) and liver cirrhosis . The virus is composed of viral nucleic acid encapsulated within a core particle, enveloped by three distinct virus-coded surface proteins: preS1, preS2, and S .

Hepatitis B Surface Antigen (HBsAg)

The hepatitis B surface antigen (HBsAg) is a protein on the surface of the hepatitis B virus. It is the primary component of the hepatitis B vaccine and is used to detect infection with the virus. The HBsAg is crucial for the virus’s ability to infect liver cells and is a target for the immune response .

PreS1 Region

The preS1 region of the hepatitis B surface antigen is essential for viral assembly and plays a major role in mediating virus attachment and entry into hepatocytes . The preS1 protein is a part of the larger HBsAg and is known for its immunogenic properties, making it a valuable component in vaccine development .

Recombinant Hepatitis B Surface Antigen, preS1

Recombinant hepatitis B surface antigen, preS1, is produced using recombinant DNA technology. This involves inserting the gene that codes for the preS1 protein into a host cell, which then produces the protein. This recombinant protein can be used in vaccines to elicit an immune response against HBV .

Vaccine Development

The development of vaccines containing the preS1 antigen has shown promising results. For instance, the Sci-B-Vac™ vaccine, which includes HBsAg as well as preS1 and preS2 antigens, has demonstrated enhanced immunogenicity compared to vaccines containing only the S antigen . Studies have shown that recognition of several preS1 epitopes is accompanied by a more pronounced antibody response to the S-gene-derived protein in healthy individuals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.