HBsAg preS2

Hepatitis B Surface Antigen, preS2 Recombinant
Cat. No.
BT8210
Source
E.coli.
Synonyms
Appearance
Purity
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.

Product Specs

Introduction
Hepatitis B virus (HBV) can cause serious liver disease in humans. The HBV surface protein antigens (HBsAg) consist of three carboxyl co-terminal HBs proteins: large (LHBs), middle (MHBs), and small (SHBs, also known as major). LHBs and MHBs share a highly hydrophobic, repetitive, membrane-spanning S domain. Additionally, MHBs has a 55 amino acid region called preS2.
Description
Recombinant Hepatitis B Surface Antigen preS2 is a single, non-glycosylated polypeptide chain consisting of 55 amino acids, with an approximate molecular weight of 5.7 kDa. It has been purified using a proprietary chromatographic technique.
Formulation
The HBsAg protein was lyophilized from a 0.2 µm filtered solution (1 mg/ml) in 20mM PB, at a pH of 7.4, with 50mM NaCl.
Solubility
Before opening, it is recommended to briefly centrifuge the vial to ensure the contents are at the bottom. Reconstitute the protein in sterile distilled water or an aqueous buffer containing 0.1% BSA to achieve a concentration of 0.1-1.0 mg/mL. Divide the stock solutions into smaller working aliquots and store them at temperatures below -20°C. Further dilutions should be prepared using appropriate buffered solutions.
Stability
The lyophilized product remains stable at temperatures between 2-8°C. However, for long-term storage, it is recommended to store it at -20°C, preferably in a desiccated environment. Once reconstituted, the preparation is stable for up to one week when stored at 2-8°C. To ensure maximum stability, divide the reconstituted preparation into working aliquots and store them at temperatures between -20°C and -70°C. Avoid repeated cycles of freezing and thawing.
Purity
Purity exceeds 95.0% as determined by: (a) Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) analysis. (b) Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE) analysis.
Source
E.coli.
Amino Acid Sequence
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.

Product Science Overview

Introduction

Hepatitis B is a significant global health concern, caused by the Hepatitis B virus (HBV). The virus can lead to both acute and chronic liver diseases, including cirrhosis and hepatocellular carcinoma. The Hepatitis B Surface Antigen (HBsAg) is a key component of the virus and plays a crucial role in the development of vaccines and diagnostic tests. Among the various forms of HBsAg, the preS2 recombinant antigen has garnered attention for its potential to enhance immune responses.

Structure and Function

The Hepatitis B virus envelope contains three surface proteins: large (L), middle (M), and small (S) proteins. These proteins are encoded by the same gene but differ in their N-terminal extensions. The preS2 region is part of the middle (M) protein and is located between the preS1 and S regions. The preS2 region is known for its immunogenic properties, making it a valuable target for vaccine development.

Recombinant Technology

Recombinant DNA technology has enabled the production of the preS2 antigen in various host systems, such as yeast and mammalian cells. This technology involves inserting the gene encoding the preS2 region into a suitable expression vector, which is then introduced into the host cells. The host cells produce the preS2 protein, which can be purified and used for various applications, including vaccine development and diagnostic assays.

Immunogenicity and Vaccine Development

The preS2 region has been shown to enhance the immunogenicity of HBsAg. Studies have demonstrated that vaccines containing the preS2 antigen can induce stronger and more durable immune responses compared to vaccines containing only the S antigen. The inclusion of the preS2 region in hepatitis B vaccines has been explored to improve the efficacy of vaccination, particularly in individuals who do not respond adequately to conventional vaccines .

Clinical Applications

Recombinant preS2 antigens are used in the development of advanced hepatitis B vaccines. These vaccines aim to provide better protection by eliciting a broader immune response. Additionally, the preS2 antigen is utilized in diagnostic assays to detect HBV infections. The presence of antibodies against the preS2 region can indicate exposure to the virus and help in the diagnosis of hepatitis B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

HBsAgA Antibody
Hepatitis B surface Antigen A, Polyclonal Goat Antibody
Cat. No.
BT4078
Source
HBsAg Paired Antibody
Mouse Anti Hepatitis B Surface Antigen Paired
Cat. No.
BT6711
Source
HBsAg preS1
Hepatitis B Surface Antigen, preS1 Recombinant
Cat. No.
BT8158
Source
Escherichia Coli.
HBsAg Recom. Antibody
Hepatitis B virus surface antigen Ck Recombinant Antibody
Cat. No.
BT19598
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.