CNTF Rat

Ciliary Neurotrophic Factor Rat Recombinant
Cat. No.
BT7901
Source
Escherichia Coli.
Synonyms
HCNTF, CNTF, Ciliary Neurotrophic Factor.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 99.0% as determined by:
(a) Analysis by Gel Filtration.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton.
The CNTF is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Ciliary neurotrophic factor (CNTF) is a polypeptide hormone primarily impacting the nervous system. It encourages neurotransmitter production and neurite development in specific neuron groups. Acting as a potent survival factor for neurons and oligodendrocytes, CNTF may mitigate tissue damage during inflammatory responses. A mutation in the CNTF gene can lead to aberrant splicing, causing ciliary neurotrophic factor deficiency, although this is not directly linked to neurological diseases. The primary transcript from this gene is monocistronic, but it can also be co-transcribed with the upstream ZFP91 gene. This co-transcription generates a transcript with a complete coding region for the zinc finger protein but an incomplete one for CNTF. In essence, CNTF is crucial for the survival of various neuronal cell types and may help prevent motor axon degeneration after injury.
Description
Recombinant Rat CNTF, produced in E. coli, is a single, non-glycosylated polypeptide chain comprising 200 amino acids. It has a molecular weight of 22.834 kDa. The purification of CNTF is achieved using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The product is lyophilized from a 1 mg/ml solution in water containing 0.025% sodium bicarbonate.
Solubility
For reconstitution, dissolve the lyophilized CNTF in sterile water or 0.4% sodium bicarbonate solution adjusted to a pH of 8-9, at a concentration of at least 100 µg/ml. This solution can be further diluted in other aqueous solutions, ideally in the presence of a carrier protein.
Stability
While lyophilized CNTF remains stable at room temperature for up to three weeks, it's best stored desiccated at a temperature below -18°C. After reconstitution, store CNTF at 4°C for no more than seven days. For long-term storage, keep it frozen below -18°C. Avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 99.0% based on the following analyses: (a) Gel Filtration and (b) SDS-PAGE.
Biological Activity
The biological activity is confirmed through its ability to phosphorylate STAT3 in various cell lines, indicating full biological functionality.
Synonyms
HCNTF, CNTF, Ciliary Neurotrophic Factor.
Source
Escherichia Coli.
Amino Acid Sequence
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNI
NLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRV
HFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPA
TVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESH
YGAKDKQM.

Product Science Overview

Structure and Source

Rat CNTF is a 22.7 kDa protein composed of 199 amino acid residues . Unlike many other proteins, it lacks a hydrophobic N-terminal sequence, which is typically required for secretion . This recombinant form of CNTF is produced in Escherichia coli (E. coli) and is highly purified, with a purity greater than 98% as determined by SDS-PAGE and HPLC analysis .

Biological Activity

CNTF is fully biologically active and has been shown to promote the survival and differentiation of various neuronal cell types . The biological activity of rat CNTF is often measured by its ability to induce the proliferation of human TF-1 cells, with an effective dose (ED50) in the range of 25-35 ng/mL .

Mechanism of Action

CNTF exerts its effects through a tripartite receptor complex consisting of two signal-transducing subunits (leukemia inhibitory factor receptor and gp130) and a CNTF-specific ligand-binding subunit (CNTFR) . This receptor complex mediates the activation of downstream signaling pathways, including the STAT3 and ERK pathways, which are crucial for neuronal survival and differentiation .

Applications and Research

CNTF has been widely used in research to study its effects on neuronal survival, differentiation, and regeneration . It has been shown to support the growth and survival of various neuronal populations, including motor neurons, sympathetic ganglion neurons, sensory neurons, hippocampal neurons, and medial septal neurons . Additionally, CNTF has been implicated in promoting neurotransmitter synthesis and neurite outgrowth in certain neuronal populations .

Storage and Handling

The lyophilized form of rat CNTF is stable at room temperature but is best stored at -20°C for long-term storage . Upon reconstitution with 5 mM Tris, pH 8.0, it can be stored at 2-8°C for up to one week or at -20°C for future use . It is important to handle the product carefully to avoid loss of activity due to repeated freezing and thawing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.