IP 10 Human
Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
Greater than 95.0% as determined by SDS-PAGE.
Description
IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa.
The IP-10 is purified by proprietary chromatographic techniques.
Product Specs
Chemokine (C-X-C motif) ligand 10 (CXCL10), also known as IP-10, is a small cytokine within the CXC chemokine family. Produced by various cells like monocytes, endothelial cells, and fibroblasts in response to interferon (IFN), CXCL10 plays roles in immune responses. These roles include attracting monocytes and T cells (chemoattraction), facilitating T cell binding to endothelial cells, suppressing tumor growth, and inhibiting angiogenesis (blood vessel formation) and bone marrow colony formation. The gene encoding CXCL10 is found on human chromosome 4, clustered with other CXC chemokine genes. CXCL10 exerts its effects by binding to the CXCR3 receptor on cell surfaces. Its three-dimensional structure has been determined in various conditions to a high resolution (1.92A).
Recombinant Human IP-10, produced in E. coli, is a single-chain polypeptide. It is non-glycosylated, containing 77 amino acids, and has a molecular weight of 8.6 kDa. The purification of IP-10 is achieved using specialized chromatographic techniques.
The product is lyophilized (freeze-dried) from a sterile aqueous solution (filtered through a 0.2-micron filter) containing 0.1% Trifluoroacetic Acid (TFA).
The purity of this product is greater than 95.0% as determined by SDS-PAGE analysis.
Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP.
Product Science Overview
CXCL10 plays a crucial role in the immune response by binding to its receptor, CXCR3. This interaction activates several signaling pathways, including ERK1/2, p38/MAPK, JNK, and PI3-kinase/AKT . These pathways lead to various cellular responses such as intracellular calcium influx, DNA synthesis, cell proliferation, and chemotaxis .
CXCL10 expression is induced by several factors, including:
- Interferon-gamma (IFN-gamma)
- Lipopolysaccharides (LPS)
- Interleukin-1 beta (IL-1 beta)
- Tumor necrosis factor-alpha (TNF-alpha)
- Interleukin-12 (IL-12)
- Viruses
In addition to monocytes, fibroblasts, and endothelial cells, CXCL10 is also expressed in activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells . It is notably present in psoriatic and lepromatous lesions of the skin .
CXCL10 has been implicated in various pathological conditions, including chronic inflammation, autoimmune diseases, and cancer. Its role in attracting immune cells to sites of inflammation makes it a potential target for therapeutic interventions.
Recombinant human CXCL10 is typically produced in E. coli and is available in both carrier-free and carrier-containing formulations . The carrier protein, often bovine serum albumin (BSA), enhances protein stability and shelf-life . The recombinant protein is lyophilized and can be reconstituted in sterile PBS for use in various research applications .
