IFN a 2a Human
Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Description
IFN Alpha Human 2a Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 19241 Dalton. The difference between IFNA2A and IFNA2B is in the amino acid present at position 23. IFN-alpha 2a has a lysine at that position 23 while IFN-alpha 2b has arginine.
The Interferon-alpha-2a gene was obtained from human leukocytes.
The IFNA2A is purified by proprietary chromatographic techniques.
Product Specs
Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a, Interferon-alpha-2a.
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE.
N-terminal methionine has been completely removed enzymatically.
Product Science Overview
IFN-Alpha 2a is a member of the type I interferon family, which includes several related proteins that share over 95% amino acid sequence homology . The recombinant form of IFN-Alpha 2a is typically produced in human embryonic kidney cells (HEK293) or E. coli . The protein has a predicted molecular mass of approximately 19 kDa and is often purified to a high degree of purity, exceeding 95% as determined by SDS-PAGE .
The primary function of IFN-Alpha 2a is to bind to specific cell surface receptors, known as IFN-alpha receptors, which consist of two subunits: IFN-alpha R1 and IFN-alpha R2 . Upon binding to these receptors, IFN-Alpha 2a triggers a cascade of intracellular signaling pathways that lead to the expression of various antiviral and immunomodulatory genes. This results in the inhibition of viral replication and modulation of the immune response .
Recombinant IFN-Alpha 2a has been extensively used in the treatment of various viral infections and cancers. It has demonstrated efficacy in conditions such as chronic hepatitis B and C, hairy cell leukemia, and Kaposi’s sarcoma . The antiviral activity of IFN-Alpha 2a is measured using assays that evaluate its ability to inhibit the cytopathic effects of viruses on cultured cells .
The recombinant IFN-Alpha 2a protein is typically formulated in phosphate-buffered saline (PBS) and may contain carrier proteins such as bovine serum albumin (BSA) to enhance stability . The protein is shipped at ambient temperature and should be stored at -20 to -70 °C to maintain its stability. It is important to avoid repeated freeze-thaw cycles to preserve its bioactivity .
