IFN a 2a Antibody

Interferon a 2a Polyclonal Rabbit Anti-Human Antibody
Cat. No.
BT5633
Source
Synonyms
Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.
Appearance
Purity

Greater than 98.0% as determined by Analysis by SDS-PAGE.

Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Product Specs

Introduction
IFN-alpha, produced by macrophages, exhibits antiviral properties by stimulating the production of two enzymes: protein kinase and oligoadenylate synthetase.
Purity
Greater than 98.0% as determined by SDS-PAGE analysis.
Formulation
Lyophilized from a 0.2 µm sterile filtered solution in phosphate buffered saline (pH 7.4).
Solubility
To reconstitute, add H₂O and mix gently. Rinse the vial sides and allow 30-60 seconds for complete dissolution before use.
Applications
ELISA: For indirect detection of Human Interferon α 2a, a minimum antibody dilution of 1:500 is recommended. When paired with compatible anti-rabbit AP conjugated secondary reagents, this antibody can detect 0.2-1 ng/well of human Interferon α 2a. Western Blot: For Western blot detection of human Interferon α2a, a dilution of 1:1,000 can be used.
Stability
Store at -20°C. For long-term storage, freeze in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
Synonyms
Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.
Purification Method
Purified IgG prepared by affinity chromatography on protein G.
Type
Polyclonal Rabbit Antibody.
Immunogen
IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.
Antigen Amino Acid Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ
IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR
ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Product Science Overview

Introduction

Interferon alpha 2a (IFN-α2a) is a type of protein known as an interferon, which plays a crucial role in the immune response against viral infections. It is produced by macrophages and has antiviral, antiproliferative, and immunomodulatory activities. The polyclonal rabbit anti-human antibody against Interferon alpha 2a is a valuable tool in research and diagnostic applications.

Production and Purification

The polyclonal antibody against Interferon alpha 2a is developed in rabbits. The immunogen used is typically a recombinant full-length protein corresponding to human IFN-α2a. The antibody is purified using affinity chromatography, often on a protein G column, to ensure high purity and specificity .

Applications

This antibody is suitable for various applications, including:

  • Western Blot (WB): Used to detect the presence of IFN-α2a in protein samples.
  • Immunohistochemistry (IHC-P): Used to visualize the distribution and localization of IFN-α2a in tissue sections.
  • Enzyme-Linked Immunosorbent Assay (ELISA): Used to quantify the amount of IFN-α2a in biological samples .
Characteristics
  • Host Species: Rabbit
  • Clonality: Polyclonal
  • Isotype: IgG
  • Immunogen: Recombinant full-length protein corresponding to human IFN-α2a
  • Purity: Greater than 98.0% as determined by SDS-PAGE .
Storage and Stability

The antibody is typically lyophilized from a sterile filtered solution in phosphate-buffered saline (PBS) with a pH of 7.4. For long-term storage, it is recommended to store the antibody at -20°C. Repeated freezing and thawing should be avoided to maintain antibody integrity .

Significance in Research

Interferon alpha 2a is a critical component of the immune response, and antibodies against it are essential for studying its role in various diseases, including viral infections and cancer. The polyclonal nature of the antibody ensures that it recognizes multiple epitopes on the IFN-α2a protein, making it a robust tool for detecting and quantifying this important cytokine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.