IL 1 beta Human, HEK

Interleukin-1 beta Human Recombinant, HEK
Cat. No.
BT29611
Source
HEK.
Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as obsereved by SDS-PAGE.
Usage
THE BioTeks products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.
The IL-1 beta is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Interleukin-1 beta (IL-1β) is a potent pro-inflammatory cytokine primarily produced by activated macrophages. It plays a crucial role in immune responses, inflammation, and cell signaling. IL-1β stimulates the proliferation of thymocytes (immature T cells) by inducing the release of interleukin-2 (IL-2). Additionally, it promotes the maturation and proliferation of B cells, which are responsible for producing antibodies. IL-1β also enhances fibroblast growth factor activity, contributing to tissue repair and wound healing. As a key mediator of inflammation, IL-1β acts as an endogenous pyrogen, inducing fever. It stimulates the release of prostaglandins and collagenase from synovial cells, contributing to joint inflammation in conditions like rheumatoid arthritis.
Description
Recombinant human Interleukin-1 beta (IL-1β), produced in HEK cells, is a glycosylated monomeric protein. Due to variations in glycosylation patterns, the molecular weight of the protein ranges from 18 to 25 kDa. The purification process involves proprietary chromatographic techniques to ensure high purity.
Physical Appearance
Sterile Filtered White lyophilized powder
Formulation
The IL-1 beta protein was lyophilized from a 1 mg/ml solution in 1x phosphate-buffered saline (PBS).
Solubility
To reconstitute the lyophilized IL-1β, it is recommended to use sterile PBS containing 0.1% endotoxin-free recombinant human serum albumin (HSA).
Stability
Lyophilized IL-1β remains stable at room temperature for up to 3 weeks. However, for long-term storage, it is recommended to store the lyophilized protein in a desiccated state below -18°C. Once reconstituted, IL-1β can be stored at 4°C for 2 to 7 days. For extended storage, freeze the reconstituted protein below -18°C. It is essential to avoid repeated freeze-thaw cycles to maintain protein stability. The addition of a carrier protein, such as 0.1% HSA or bovine serum albumin (BSA), is recommended for long-term storage.
Purity
The purity of the protein is determined by SDS-PAGE analysis and is greater than 95%.
Biological Activity
The biological activity of IL-1β is determined by its ability to stimulate the proliferation of mouse D10S cells. The specific activity, measured as the effective concentration inducing a half-maximal response (EC50), is typically in the range of 0.02 to 0.08 ng/ml.
Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source
HEK.
Amino Acid Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP
VALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFES
AQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS.

Product Science Overview

Structure and Production

IL-1β is initially synthesized as a proprotein, which is then proteolytically processed to its active form by caspase 1 (also known as interleukin 1 beta convertase) . The mature IL-1β protein is a glycosylated monomer with a molecular mass of 18-25 kDa . The glycosylation of IL-1β contributes to its stability in cell growth media and other applications .

Recombinant human IL-1β, expressed in human embryonic kidney (HEK) 293 cells, offers authentic glycosylation, which is essential for its biological activity . The production of IL-1β in HEK 293 cells ensures that the recombinant protein closely mimics the natural human protein in terms of structure and function .

Biological Functions

IL-1β plays a pivotal role in the inflammatory response and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis . It is an important mediator of the inflammatory response and is known to induce the expression of cyclooxygenase-2 (COX-2) in the central nervous system, contributing to inflammatory pain hypersensitivity .

Additionally, IL-1β, in combination with IL-23, induces the expression of IL-17, IL-21, and IL-22 by γδ T cells, suggesting its involvement in the modulation of autoimmune inflammation . Different inflammasome complexes recognize danger signals and activate the production of IL-1β and IL-18, playing a role in various diseases such as type 2 diabetes mellitus, Alzheimer’s disease, obesity, and atherosclerosis .

Applications

Recombinant human IL-1β is widely used in research and clinical applications due to its role in immune and inflammatory responses. It is suitable for cell culture and is endotoxin tested to ensure its safety and efficacy in various experimental setups . The recombinant protein is available in lyophilized form and can be reconstituted for use in various assays and studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.