IL 1 beta Rat
Greater than 96.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Description
The IL-1b is purified by proprietary chromatographic techniques.
Product Specs
Interleukin-1 beta (IL-1β) is a cytokine primarily produced by activated macrophages. It plays a crucial role in stimulating the immune system, including promoting the proliferation of thymocytes (T cell precursors) by triggering the release of interleukin-2 (IL-2). Additionally, IL-1β contributes to the maturation and proliferation of B cells, which are responsible for producing antibodies. It also enhances the activity of fibroblast growth factor, a protein involved in cell growth and tissue repair. As an endogenous pyrogen, IL-1β is recognized for its involvement in the inflammatory response and its ability to induce fever. Furthermore, it has been observed to stimulate the release of prostaglandin, a hormone-like substance, from synovial cells, which are found in joints.
The protein solution was subjected to filtration through a 0.2µm filter before being lyophilized. The formulation buffer consists of PBS at pH 7.4, 5% trehalose, and 0.02% Tween-20.
The purity of this product exceeds 96.0%, as determined by the following methods:
(a) Reverse-phase high-performance liquid chromatography (RP-HPLC) analysis.
(b) Sodium dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE) analysis.
VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK
KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD
IVDFTMEPVSS.
Product Science Overview
Recombinant rat IL-1β is typically produced in Escherichia coli (E. coli) expression systems. The protein corresponds to the full-length mature rat IL-1β, which consists of 153 amino acid residues and has a molecular weight of approximately 17.3 kDa . The recombinant protein is purified and lyophilized for research use.
IL-1β is synthesized as an inactive precursor, known as pro-IL-1β, which accumulates in the cytosol. The activation of inflammasomes, multi-protein complexes that respond to pathogens and stress conditions, triggers the processing of pro-IL-1β into its active form. This process involves the cleavage of pro-IL-1β by caspase-1, resulting in the active 17 kDa protein .
Once activated, IL-1β mediates a wide range of immune responses, including the activation of B and T cells, the induction of fever, and the promotion of inflammation. It signals through two receptors, IL-1RI and IL-1RII, both of which are shared with IL-1 alpha .
Recombinant rat IL-1β is widely used in research to study its role in various biological processes and diseases. Some common applications include:
- Cell Proliferation Assays: IL-1β is used to stimulate the proliferation of certain cell lines, such as murine D10S cells, to study cell growth and differentiation .
- Inflammation Studies: Researchers use IL-1β to investigate the mechanisms of inflammation and the effects of anti-inflammatory drugs.
- Immune Response Research: IL-1β is used to study the activation and regulation of immune cells, including macrophages and dendritic cells.
Recombinant rat IL-1β is typically supplied as a lyophilized powder, which should be reconstituted with distilled water. Care should be taken during reconstitution, as the protein may appear as a film at the bottom of the vial. The reconstituted protein should be stored at -20°C to maintain its stability and activity .
