IL 1 beta Human, His
Greater than 95.0% as determined by SDS-PAGE.
Description
The IL-1b His is purified by proprietary chromatographic techniques.
Product Specs
The IL-1b His tag protein is supplied in a solution containing 20mM Tris-HCl at pH 8.0 and 50% glycerol.
The purity is determined to be greater than 95.0% using SDS-PAGE analysis.
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV
QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME
KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Product Science Overview
IL-1β is initially produced as an inactive precursor protein, known as pro-IL-1β, which is synthesized in response to inflammatory stimuli. This precursor is a 31 kDa protein that accumulates in the cytosol of cells such as monocytes, macrophages, and dendritic cells . The activation of inflammasomes, which are multi-protein complexes responding to pathogens and stress conditions, triggers the processing of the caspase-1 precursor into its active form. Caspase-1 then cleaves pro-IL-1β into its active 17 kDa form .
Recombinant IL-1β proteins are produced using various expression systems, such as E. coli. These recombinant proteins often include a polyhistidine tag (His Tag) at the N-terminus to facilitate purification and detection . The His Tag allows for easy purification using nickel affinity chromatography, which binds to the histidine residues.
For example, the recombinant human IL-1β protein with a His Tag is expressed from E. coli cells and contains amino acids Ala117-Ser269 . This protein has a calculated molecular weight of approximately 19.3 kDa and migrates as 19-20 kDa under reducing conditions in SDS-PAGE . The purity of this protein is typically greater than 95% as determined by SDS-PAGE .
IL-1β is a potent immunomodulator that mediates a wide range of immune and inflammatory responses. It signals through two receptors, IL-1RI and IL-1RII, both of which are shared with IL-1 alpha . The activity of IL-1β can be moderated by the IL-1 Receptor Antagonist (IL-1RA), which blocks receptor binding through competitive inhibition .
IL-1β plays a significant role in innate host defense by triggering the production of other proinflammatory cytokines in target cells and initiating acute-phase responses to infection and injury . Elevated levels of IL-1β have been associated with various chronic inflammatory conditions, making it a target for therapeutic interventions .
