IL 17 A/F Mouse

Interleukin-17 A/F Heterodimer Mouse Recombinant
Cat. No.
BT30960
Source
Escherichia Coli.
Synonyms
IL17A/F, IL17 A/F, IL-17A/F, IL-17 A/F, IL17AF, IL-17 AF, Interleukin-17 A/F, Interleukin-17 AF.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Interleukin-17 A/F Mouse Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa.
The IL-17 A/F is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Human IL-17A/F is a heterodimeric glycoprotein with a molecular weight of 40 kDa. It comprises two members of the IL-17 family, IL-17A and IL-17F, linked by a disulfide bond. IL-17 family homodimers share a structural feature known as a cysteine knot motif, characterized by the presence of two disulfide bonds. The human IL-17A precursor consists of 155 amino acids, including a 23 amino acid signal sequence and a 132 amino acid chain with an N-linked glycosylation site. Human IL-17F, similarly, is produced as a 153 amino acid precursor, encompassing a 20 amino acid signal sequence and a 133 amino acid region, also containing an N-linked glycosylation site. The amino acid sequences of IL-17A and IL-17F exhibit 50% identity. In comparison to mouse IL-17A and IL-17F, human IL-17A and IL-17F share approximately 60% amino acid sequence homology. Activated CD4+ T cells, known as Th17 cells, are responsible for the production of IL-17A/F, IL-17A homodimers, and IL-17F homodimers. The cytokine IL-23 stimulates Th17 lymphocytes to produce IL-17A/F. Binding of IL-17A and IL-17F is facilitated by a heterodimer formed by IL-17RA and IL-17RC. Specifically, IL-17A/F binds to the IL-17RA receptor. IL-17A/F exhibits intermediate potency in inducing chemokine production and airway neutrophilia, with IL-17A being the most potent and IL-17F being the least potent.
Description
Recombinant Mouse Interleukin-17 A/F, produced in E. coli, is a non-glycosylated heterodimeric polypeptide. It consists of an IL-17A monomeric subunit and an IL-17F monomeric subunit. With a total of 266 amino acids, it has a molecular weight of 29.8 kDa. The purification of IL-17 A/F is achieved through proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
Lyophilized from a 1 mg/ml solution without any additives.
Solubility
To reconstitute the lyophilized Mouse IL-17 A/F, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a concentration of at least 100 µg/ml. Further dilutions can be prepared in other aqueous solutions.
Stability
Lyophilized Mouse IL-17 A/F, though stable at room temperature for up to 3 weeks, should be stored in a dry environment below -18°C. After reconstitution, it is advisable to store Mouse IL-17 A/F at 4°C for a period of 2 to 7 days. For prolonged storage, freezing at -18°C is recommended. To enhance long-term stability during storage, consider adding a carrier protein like HSA or BSA (0.1%). Avoid repeated freeze-thaw cycles.
Purity
Purity exceeding 97.0% as determined by SDS-PAGE analysis.
Synonyms
IL17A/F, IL17 A/F, IL-17A/F, IL-17 A/F, IL17AF, IL-17 AF, Interleukin-17 A/F, Interleukin-17 AF.
Source
Escherichia Coli.
Amino Acid Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR
EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQ
NVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWE
AQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLV
GVGCTCVASIVRQAA.

Product Science Overview

Introduction

Interleukin-17 (IL-17) is a family of pro-inflammatory cytokines that play a crucial role in the immune response. Among the IL-17 family, IL-17A and IL-17F are particularly significant due to their involvement in various inflammatory and autoimmune diseases. The IL-17A/F heterodimer is a unique cytokine composed of one IL-17A subunit and one IL-17F subunit, forming a biologically active protein that exhibits properties distinct from the IL-17A and IL-17F homodimers.

Structure and Production

The IL-17A/F heterodimer is a disulfide-linked protein produced by an activated subset of CD4+ T cells, known as Th17 cells . In mice, the recombinant IL-17A/F heterodimer is typically expressed in E. coli and purified to achieve high purity levels (>95%) as determined by SDS-PAGE under reducing conditions . The molecular masses of the IL-17A and IL-17F subunits are approximately 14.9 kDa and 15.5 kDa, respectively .

Biological Activity

The IL-17A/F heterodimer is known for its ability to induce the secretion of pro-inflammatory cytokines and chemokines, such as IL-6, from various cell types, including fibroblasts and epithelial cells . This cytokine plays a pivotal role in bridging the innate and adaptive immune responses by promoting the recruitment of neutrophils to sites of inflammation . The bioactivity of the IL-17A/F heterodimer is intermediate between that of the IL-17A and IL-17F homodimers, with IL-17A being the most potent and IL-17F the least potent .

Role in Disease

IL-17A/F has been implicated in several inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease . The cytokine’s ability to drive the production of other pro-inflammatory mediators makes it a critical player in the pathogenesis of these conditions. Elevated levels of IL-17A/F have been observed in the affected tissues of patients with these diseases, highlighting its role in disease severity and progression .

Applications in Research

Recombinant mouse IL-17A/F heterodimer is widely used in research to study its biological functions and therapeutic potential. It serves as a valuable tool for investigating the mechanisms underlying Th17 cell differentiation and the cytokine’s role in various disease models . Additionally, the recombinant protein is used in drug development to identify potential therapeutic targets for treating IL-17A/F-mediated diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

IL17D Human
Interleukin-17D Human Recombinant
Cat. No.
BT9563
Source
Escherichia Coli.
IL17E Mouse
Interleukin-17E Mouse Recombinant
Cat. No.
BT9697
Source
Escherichia Coli.
IL17RB Human
Interleukin-17 Receptor Beta Human Recombinant
Cat. No.
BT10277
Source
<p>Sf9, Baculovirus cells.</p>
IL 17A/F Human
Interleukin-17A/F Heterodimer Human Recombinant
Cat. No.
BT31005
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.