Introduction
IL-25, also known as IL-17E, is a cytokine that shares sequence similarity with IL-17. It activates NF-kappaB and stimulates IL-8 production. Both IL-17E and IL-17B act as ligands for the IL-17BR cytokine receptor. As a pro-inflammatory cytokine, IL-25 promotes Th2-type immune responses. Intracellular JNK, p38 MAPK, and NF-kappaB activity differentially regulate the upregulation of costimulation-induced IL-17E receptors and the release of cytokines and chemokines from IL-17E-treated, costimulated Th cells. Blocking interleukin-25 can prevent airway hyperresponsiveness, a key characteristic of asthma. Produced by innate effector eosinophils and basophils, IL-25 exacerbates allergic inflammation by supporting the persistence and function of TSLP-DC-activated adaptive Th2 memory cells. In a transgenic mouse model, IL-25 overexpression leads to increased Th2 cytokine gene expression, growth retardation, jaundice, and widespread inflammation. IL-25 contributes to the initiation and maintenance of eosinophilic inflammation by acting on lung fibroblasts. This supports the understanding of IL-17E as a significant factor in asthma pathophysiology. Although IL-17E amplifies TH2 cell-mediated allergic airway inflammation, it does not independently induce allergic inflammation in vivo.
Description
Recombinant mouse IL-17E is a non-glycosylated homodimer with a disulfide bond, consisting of two 145 amino acid chains, resulting in a total molecular weight of 35.5 kDa. Purification of the mouse IL-17E is achieved using specialized chromatographic methods.
Physical Appearance
Sterile filtered white lyophilized (freeze-dried) powder.
Formulation
The IL-17E was lyophilized from a concentrated solution (1 mg/mL) without any additional ingredients.
Solubility
For reconstitution of the lyophilized Mouse IL-17E, it is advised to use sterile 10mM HCl. The concentration should be at least 100 µg/mL. Further dilution into other aqueous solutions is possible after this initial reconstitution.
Stability
Lyophilized murine IL-17E remains stable at room temperature for up to 3 weeks. However, for long-term storage, it is recommended to store it in a dry environment below -18°C. Once reconstituted, IL-17E should be stored at 4°C for a period of 2 to 7 days. For storage beyond this period, it should be kept at -18°C. To ensure long-term stability, adding a carrier protein like 0.1% HSA or BSA is advised. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 95.0%, as determined by:
(a) Reverse-phase high-performance liquid chromatography (RP-HPLC) analysis.
(b) Sodium dodecyl-sulfate polyacrylamide gel electrophoresis (SDS-PAGE) analysis.
Biological Activity
The biological activity is measured by the dose-dependent production of IL-8 in human peripheral blood mononuclear cells (PBMCs). The activity range is 322-488 ng/mL.
Synonyms
IL-25, IL-17E, IL17E, IL25, Interleukin-25.
Amino Acid Sequence
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS
PPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRD
LNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL
YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV
CVRPRVMA.
