EBI3 Human
Epstein Barr Virus Induced 3 Human Recombinant
Cat. No.
BT20754
Source
Escherichia Coli.
Synonyms
Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 90% as determined by
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs 
In Stock 
Description
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
The EBI3 is purified by proprietary chromatographic techniques.
The EBI3 is purified by proprietary chromatographic techniques.
Product Specs
Introduction
When B lymphocytes are exposed to Epstein-Barr virus infection, they exhibit an increased expression of EBI3. The EBI3 gene encodes a secreted glycoprotein that is classified as a member of the hematopoietin receptor family. It forms a heterodimer with a 28 kDa protein, resulting in the creation of iIL-27. EBI3 plays a crucial role in the rapid clonal expansion of naive CD4+ T cells. Additionally, EBI3 exhibits a strong synergistic effect with IL-12, leading to the activation of IFN-gamma production in naive CD4+ T cells. EBI3 exerts its biological effects through the cytokine receptor WSX-1/TCCR.
Description
Recombinant Human EBI3, produced in E. coli, is a single, non-glycosylated polypeptide chain. This chain comprises 209 amino acids (fragment 21-229) and has a molecular weight of 23.3 kDa. The purification of EBI3 is achieved using proprietary chromatographic methods.
Physical Appearance
White, sterile-filtered powder that has been lyophilized (freeze-dried).
Formulation
Recombinant Human EBI3 was lyophilized from a solution consisting of 10 mM Acetic Acid and 0.5% Mannitol.
Solubility
To reconstitute the lyophilized EBI3, it is recommended to dissolve it in sterile 10 mM Acetic acid at a concentration of at least 100 µg/ml. This solution can then be further diluted in other aqueous solutions.
Stability
Although lyophilized EBI3 remains stable at room temperature for a period of 3 weeks, it is advisable to store it in a desiccated state below -18°C. Once reconstituted, EBI3 should be kept at 4°C for 2-7 days. For long-term storage, it is recommended to store it below -18°C. It is important to avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 90% using the following methods:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Biological Activity
The assay data for recombinant Human EBI3 is determined by its qualitative binding affinity to anti-EBI3 antibody.
Synonyms
Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.
Source
Escherichia Coli.
Amino Acid Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF
IATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVL
NVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQ
VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSF
ILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
IATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVL
NVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQ
VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSF
ILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
Product Science Overview
Structure and Function
EBI3 is a secreted glycoprotein and a member of the hematopoietin receptor family, related to the p40 subunit of interleukin-12 (IL-12) . It plays a crucial role in regulating cell-mediated immune responses . EBI3 is a subunit in two distinct heterodimeric cytokines: Interleukin-27 (IL-27) and Interleukin-35 (IL-35) .
Human Recombinant EBI3
Biological Processes
EBI3 is involved in several biological processes, including :
- T-helper 1 type immune response
- T cell proliferation
- Humoral immune response
- Positive regulation of alpha-beta T cell proliferation
- Regulation of signaling receptor activity
- Interleukin-27-mediated signaling pathway
- Interleukin-35-mediated signaling pathway
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
