Acrp30 Protein

Adiponectin Human Recombinant
Cat. No.
BT7626
Source
Escherichia Coli.
Synonyms
Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Appearance
Sterile Filtered clear solution.
Purity
Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).

Product Specs

Introduction
Adiponectin (Acrp30) is a protein hormone exclusively produced and secreted by adipose tissue. It plays a crucial role in regulating various physiological processes, including energy balance, insulin sensitivity, hormone activity, fatty acid metabolism, and body weight. Acrp30 circulates in the bloodstream. Individuals with obesity, insulin resistance, and type 2 diabetes often exhibit reduced plasma adiponectin levels, which are linked to insulin resistance and elevated insulin levels. Structurally, Acrp30 comprises an N-terminal collagenous domain followed by a C-terminal globular domain. Beyond its metabolic functions, Acrp30 serves as a significant negative regulator of hematopoiesis and the immune system, potentially contributing to the resolution of inflammatory responses through its inhibitory actions. For instance, adiponectin suppresses endothelial NF-kappa-b signaling via a cAMP-dependent pathway and inhibits the TNF-alpha-induced expression of endothelial adhesion molecules.
Description
Recombinant Human Adiponectin protein is produced in E. coli. This protein is a single, non-glycosylated polypeptide chain with a molecular weight of 25.1 kDa, consisting of 231 amino acids (15-244).
Physical Appearance
Clear, sterile-filtered solution.
Formulation
The Acrp30 protein solution is formulated in phosphate-buffered saline (PBS) at pH 7.4 and contains 1mM DTT.
Stability
For short-term storage (2-4 weeks), the protein can be stored at 4°C. For extended storage, freeze the protein at -20°C. The addition of a carrier protein (0.1% HSA or BSA) is recommended for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
The purity of Acrp30 is greater than 90% as determined by SDS-PAGE analysis.
Synonyms
Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Source
Escherichia Coli.
Amino Acid Sequence
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE
KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV
GLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKD
VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE
RNGLYADNDNDSTFTGFLLYHDTN.

Product Science Overview

Introduction

Adiponectin, also known as Acrp30, AdipoQ, GBP-28, APM-1, and ACDC, is a protein hormone predominantly secreted by adipose tissue. It plays a crucial role in regulating metabolic processes such as glucose regulation and fatty acid oxidation. The recombinant form of human adiponectin is produced using various expression systems, including Escherichia coli and mammalian cells .

Structure and Function

Adiponectin is a 25.1 kDa protein composed of 231 amino acids. It has a modular structure consisting of an N-terminal collagenous domain followed by a C-terminal globular domain . This structure allows adiponectin to form various multimeric complexes, including trimers, hexamers, and high molecular weight (HMW) forms, which are essential for its biological activity .

Adiponectin exerts its effects through several mechanisms:

  • Energy Homeostasis: It enhances insulin sensitivity and promotes glucose uptake in tissues.
  • Fatty Acid Metabolism: It stimulates fatty acid oxidation and reduces lipid accumulation.
  • Anti-inflammatory Effects: It inhibits endothelial NF-kappa-B signaling and TNF-alpha-induced expression of endothelial adhesion molecules .
Production and Stability

Recombinant human adiponectin is typically produced in Escherichia coli, resulting in a non-glycosylated polypeptide chain . Recent advancements have explored the use of genome-edited chickens as a sustainable platform for producing multimeric and functional recombinant human adiponectin . This method has shown promise in generating stable and biologically active forms of adiponectin across generations.

For storage, the recombinant protein is formulated in phosphate-buffered saline (PBS) with 1mM DTT and should be stored at 4°C for short-term use or frozen at -20°C for long-term storage. It is recommended to add a carrier protein, such as 0.1% HSA or BSA, to prevent multiple freeze-thaw cycles .

Therapeutic Potential

Adiponectin has garnered significant interest for its potential therapeutic applications in metabolic and cardiovascular diseases. Reduced levels of adiponectin are associated with conditions such as obesity, insulin resistance, and type 2 diabetes . By enhancing insulin sensitivity and exerting anti-inflammatory effects, adiponectin holds promise as a therapeutic target for these conditions .

Moreover, the high molecular weight (HMW) form of adiponectin is considered the most biologically active and is closely correlated with the risk of atherosclerosis and endothelial dysfunction . Research continues to explore the therapeutic potential of adiponectin in various diseases, aiming to harness its beneficial effects for clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.