VEGI Human
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Description
Product Specs
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHL
TVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKF
LLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSIT
VVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAM
FSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.
Product Science Overview
Human Vascular Endothelial Growth Inhibitor (VEGI) is a protein that plays a crucial role in regulating angiogenesis, the process through which new blood vessels form from pre-existing vessels. Angiogenesis is essential for various physiological processes, including wound healing and embryonic development, but it also plays a significant role in the progression of diseases such as cancer. Recombinant technology allows for the production of VEGI in a laboratory setting, enabling researchers to study its functions and potential therapeutic applications.
VEGI belongs to the tumor necrosis factor (TNF) superfamily and is known for its ability to inhibit the proliferation of endothelial cells, which line the interior surface of blood vessels. By binding to specific receptors on these cells, VEGI can induce apoptosis (programmed cell death) and inhibit angiogenesis. This makes it a potential candidate for anti-cancer therapies, as it can starve tumors of the blood supply they need to grow and metastasize.
Recombinant VEGI is produced using genetic engineering techniques. The gene encoding VEGI is inserted into an expression vector, which is then introduced into a host cell, such as bacteria or yeast. These host cells are cultured under conditions that promote the expression of the VEGI protein, which can then be purified for research or therapeutic use.
One of the most promising applications of recombinant VEGI is in cancer therapy. By inhibiting angiogenesis, VEGI can potentially reduce tumor growth and spread. Studies have shown that combining VEGI with other treatments, such as immune checkpoint inhibitors, can enhance its anti-tumor effects . For example, a study involving elderly patients with non-small cell lung cancer (NSCLC) demonstrated that combining recombinant VEGI with anti-PD-1 therapy improved progression-free survival and overall survival .
Despite its potential, there are several challenges associated with the use of recombinant VEGI. One of the main issues is the potential for toxicity, as inhibiting angiogenesis can also affect normal physiological processes. Additionally, the production of recombinant proteins can be complex and costly. Future research is focused on improving the efficacy and safety of VEGI-based therapies, as well as developing more efficient production methods .
