VEGF (121 a.a.) Human, Sf9

Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9
Cat. No.
BT6134
Source
Sf9, Insect Cells.
Synonyms
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.
VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates.
The VEGF-121 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Vascular endothelial growth factor (VEGF) is a crucial signaling protein for vasculogenesis and angiogenesis. While primarily known for its effects on vascular endothelial cells, VEGF also impacts other cell types like monocytes, macrophages, neurons, cancer cells, and kidney epithelial cells. VEGF promotes vascular permeability, angiogenesis, vasculogenesis, endothelial cell growth, and cell migration, while also inhibiting apoptosis. In vitro studies demonstrate its ability to stimulate endothelial cell mitogenesis and migration. Additionally, VEGF acts as a vasodilator, enhancing microvascular permeability. It was initially termed 'vascular permeability factor.' Elevated levels of VEGF are associated with POEMS syndrome (Crow-Fukase syndrome). Mutations in the VEGF gene are linked to both proliferative and nonproliferative diabetic retinopathy.
Description
Recombinant Human Vascular Endothelial Growth Factor-121, produced in insect cells, is a glycosylated homodimer with a molecular weight of approximately 36kDa. It comprises two 18kDa polypeptide chains, each containing 121 amino acids. VEGF121 exhibits greater circulatory freedom compared to other VEGF forms due to its weaker binding affinity to vascular heparin sulfates. Purification is achieved through proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
The protein was lyophilized from a 50mM acetic acid solution.
Solubility
Reconstitute the lyophilized VEGF121 in 50mM acetic acid to a minimum concentration of 50 µg/ml.
Stability
Lyophilized VEGF121 remains stable at room temperature for up to 3 weeks. However, it is recommended to store the lyophilized protein desiccated at temperatures below -18°C. After reconstitution, VEGF-121 can be stored at 4°C for 2-7 days. For long-term storage, freeze at -18°C after adding a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
Purity
Purity is determined to be greater than 95% by SDS-PAGE analysis.
Biological Activity
The biological activity is assessed through a cell proliferation assay using primary human umbilical vein endothelial cells (HUVECs). The ED50 for this effect is typically in the range of 2-10 ng/ml.
Synonyms
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Source
Sf9, Insect Cells.
Amino Acid Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.

Product Science Overview

Introduction

Vascular Endothelial Growth Factor (VEGF) is a critical signaling protein involved in both vasculogenesis and angiogenesis. The specific isoform, VEGF-121, is a splice variant of VEGF-A and plays a significant role in vascular endothelial cell survival, growth, migration, and vascular permeability .

Structure and Production

VEGF-121 is a glycosylated polypeptide chain containing 121 amino acids, with a molecular mass of approximately 36 kDa when produced in insect cells (Sf9). It forms an 18 kDa homodimer . This isoform circulates more freely compared to other VEGF forms, which bind more tightly with vascular heparin sulfates .

Biological Activity

VEGF-121 mediates increased vascular permeability, induces angiogenesis, vasculogenesis, and endothelial cell growth, promotes cell migration, and inhibits apoptosis. It has been shown to stimulate endothelial cell mitogenesis and cell migration in vitro . VEGF-121 binds to VEGFR1 and VEGFR2 receptor tyrosine kinases, leading to the activation of pathways involving PI3K/Akt, p38 MAPK, and FAK .

Expression and Regulation

VEGF-121 is produced by various cell types, including endothelial cells, macrophages, and T cells. Its expression is induced by hypoxia, inflammatory cytokines, and oncogene products in tumors . Elevated levels of VEGF are linked to several pathological conditions, such as proliferative and nonproliferative diabetic retinopathy and POEMS syndrome .

Applications

Recombinant VEGF-121 is used extensively in research to study its effects on angiogenesis and vascular permeability. It is also utilized in cell proliferation assays using primary human umbilical vein endothelial cells (HUVECs), where it demonstrates significant bioactivity .

Storage and Stability

The recombinant VEGF-121 protein is typically supplied as a lyophilized powder. It is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term storage. Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term use. To prevent loss of potency, it is recommended to add a carrier protein (0.1% HSA or BSA) and avoid multiple freeze-thaw cycles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.