TNFR Human, His

Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag
Cat. No.
BT26480
Source
Escherichia Coli.
Synonyms
Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Appearance
Sterile Filtered clear solution.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.

Product Specs

Introduction
TNFR1, a member of the TNF-receptor superfamily, binds to TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. Two soluble TNF receptors, sTNFR-I and sTNFR-II, neutralize the biological activities of TNF alpha and TNF beta. These soluble receptors increase due to shedding of the extracellular domains from membrane-bound receptors. TNF-a, TNFR1, and TNFR2 are involved in cellular differentiation, while TNFR1 and TNFR2 play roles in cell type-specific renal injury. TNFR1 signals both cell survival and apoptosis. TNFR1-induced apoptosis relies on two sequential signaling complexes. This receptor can activate NF-kappaB, mediate apoptosis, and regulate inflammation. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, leading to ligand-independent and enhanced ligand-dependent TNF signaling. TNFR1 contributes to non-cytocidal TNF effects, such as anti-viral state induction and acid sphingomyelinase activation. Human TNFR1 possesses a major region controlling cell surface expression. Amniotic fluid of pregnant women contains high levels of soluble TNF receptors. Germline mutations in TNFR1's extracellular domains are linked to the autosomal dominant periodic fever syndrome. Impaired receptor clearance is thought to contribute to the disease mechanism. Defects in the TNFRSF1A gene cause familial hibernian fever (FHF).
Description
Recombinant Human TNFR, produced in E. coli, is an unglycosylated polypeptide chain (161 amino acids). This fragment (amino acids 41-201) has a molecular weight of 22.68 kDa and includes a 4.5 kDa N-terminal hexahistidine tag. Purification of the TNFR His Tag is achieved through proprietary chromatographic techniques.
Physical Appearance
A clear solution, sterilized by filtration.
Formulation
The TNFR His Tag protein is provided in a buffer consisting of 1xPBS and 50% glycerol.
Stability
For use within 2-4 weeks, store at 4°C. For longer storage, freeze at -20°C. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 95.0% as determined by SDS-PAGE analysis.
Synonyms
Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Source
Escherichia Coli.
Amino Acid Sequence
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQ
DTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVE
ISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCL
NGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKK
SLECTKLCLPQIEN.

Product Science Overview

Introduction

Tumor Necrosis Factor Receptors (TNFRs) are a group of receptors that bind to Tumor Necrosis Factors (TNFs), which are cytokines involved in systemic inflammation and are part of the body’s immune response. The TNFR family plays a crucial role in regulating immune cells, apoptosis, and inflammation.

Structure and Function

The Tumor Necrosis Factor Receptor Type (Human Recombinant, His Tag) is a recombinant protein produced in E. coli. It is a single, non-glycosylated polypeptide chain containing 161 amino acids, with a molecular weight of approximately 22.68 kDa. This protein is fused with a 4.5 kDa amino-terminal hexahistidine tag (His Tag) to facilitate purification and detection .

The TNFRs are characterized by their ability to bind TNFs via an extracellular cysteine-rich domain. This interaction is crucial for the receptor’s role in mediating the effects of TNFs, which include cell proliferation, differentiation, and apoptosis .

Types of TNFRs

There are two main types of TNFRs:

  1. TNFR1 (Tumor Necrosis Factor Receptor 1): This receptor is ubiquitously expressed and can induce apoptosis, inflammation, and immune responses.
  2. TNFR2 (Tumor Necrosis Factor Receptor 2): This receptor is primarily found on immune cells and is involved in immune regulation and tissue regeneration .
Applications

The recombinant form of TNFR with a His Tag is widely used in research and therapeutic applications. The His Tag allows for easy purification and detection using nickel affinity chromatography and anti-His antibodies, respectively. This makes it a valuable tool for studying the receptor’s function and for developing therapeutic agents targeting TNFRs.

Therapeutic Potential

TNFRs, particularly TNFR2, have been identified as potential therapeutic targets for various diseases, including cancer and autoimmune disorders. TNFR2 promotes tumor immune escape by stimulating immune suppressive cell types, such as regulatory T-cells (Tregs) and myeloid-derived suppressor cells (MDSCs). This makes it a promising target for cancer immunotherapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.