TPO Human, HEK
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
The TPO is purified by proprietary chromatographic techniques.
Product Specs
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPT
PTSPLLNTSYTHSQNLSQEG
Product Science Overview
Thrombopoietin was first purified in 1994, and since then, two recombinant forms have been developed: recombinant human thrombopoietin (rhTPO) and pegylated recombinant human megakaryocyte growth and development factor (PEG-rHuMGDF) . These recombinant forms have undergone extensive clinical investigation and have shown significant potential in stimulating megakaryocyte growth and platelet production .
Thrombopoietin binds to its receptor, TpoR (also known as c-Mpl), on the surface of megakaryocytes and their progenitors. This binding activates several intracellular signaling pathways, including the JAK-STAT, MAPK, and PI3K-AKT pathways, which promote the survival, proliferation, and differentiation of megakaryocytes .
Recombinant human thrombopoietin (rhTPO) has been investigated for its potential to treat various conditions associated with thrombocytopenia (low platelet count). These conditions include:
- Chemotherapy-induced thrombocytopenia: rhTPO has shown promise in reducing thrombocytopenia caused by nonmyeloablative chemotherapy .
- Chronic thrombocytopenia: Studies have explored the use of rhTPO in treating chronic thrombocytopenia associated with myelodysplastic syndromes, idiopathic thrombocytopenic purpura, HIV, and liver disease .
- Surgical thrombocytopenia: Animal studies suggest that TPO may be effective in reducing surgical thrombocytopenia and bleeding .
Recombinant human thrombopoietin is produced using various expression systems, including Chinese hamster ovary (CHO) cells and human embryonic kidney (HEK) cells. The HEK cell system is particularly advantageous due to its ability to produce glycosylated proteins that closely resemble their natural counterparts .
Ongoing and future studies aim to further define the clinical role of recombinant TPO and TPO mimetics in the treatment of chemotherapy- and nonchemotherapy-induced thrombocytopenia . Additionally, research is being conducted to explore the potential of TPO in ex vivo expansion of pluripotent stem cells and as a radioprotectant .
