SPP1 Human, HEK

Osteopontin Human Recombinant, HEK
Cat. No.
BT25688
Source
HEK293 cells.
Synonyms
Secreted Phosphoprotein-1, OPN, BNSP, BSPI, ETA-1, MGC110940, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, Nephropontin, Uropontin, SPP1.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation).
Osteopontin is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Osteopontin (also known as SPP1) is a protein with diverse functions. It plays a role in bone formation, immune responses, and tissue repair. It is found in various cells and tissues and is involved in interactions between cells and the surrounding environment. Osteopontin has been linked to various diseases, including heart disease, liver cancer, and lung conditions.
Description
This product contains human Osteopontin protein produced in a lab setting using HEK293 cells. It is a highly purified, full-length version of the protein with a tag for easy detection and purification. The protein may appear larger than its calculated size on some laboratory tests due to the addition of sugar molecules.
Physical Appearance
The product is provided as a white powder that has been sterilized and freeze-dried.
Formulation

The Osteopontin protein has been freeze-dried in a specific solution to ensure stability and solubility.

Solubility
To use the product, dissolve it in a phosphate buffer solution (PBS) at a concentration of at least 100 micrograms per milliliter. The solution can then be diluted further with water or other appropriate solutions.
Stability
To maximize shelf life, store the product at 4°C for up to a month, or freeze it at -20°C for longer storage. Avoid repeated freezing and thawing.
Purity
This product contains highly pure Osteopontin protein, with a purity level of over 95% as determined by SDS-PAGE analysis.
Synonyms
Secreted Phosphoprotein-1, OPN, BNSP, BSPI, ETA-1, MGC110940, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, Nephropontin, Uropontin, SPP1.
Source
HEK293 cells.
Amino Acid Sequence
IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL
PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDEL
VTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDIT
SHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRK
ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDS
ASSEVNVDHHHHHH.

Product Science Overview

Expression and Production

Recombinant human osteopontin is commonly expressed in HEK 293 cells (Human Embryonic Kidney 293 cells), which are widely used for the production of recombinant proteins due to their high transfection efficiency and ability to perform complex post-translational modifications . The recombinant form of osteopontin expressed in HEK 293 cells typically migrates at an apparent molecular weight of 60.0-65.0 kDa by SDS-PAGE analysis under reducing conditions .

Biological Functions

Osteopontin is a secreted glycoprotein that functions as a ligand for integrins, particularly αvβ3 integrin, and possibly other receptors . It binds tightly to hydroxyapatite, acting as a structural component of the extracellular mineralized matrix . Beyond its role in bone mineralization, osteopontin functions as a cytokine, stimulating the release of interferon-gamma (IFN-γ) and interleukin-12 (IL-12), while inhibiting the production of interleukin-10 (IL-10) .

Involvement in Diseases

Osteopontin is implicated in various diseases due to its role in inflammation and immune regulation. It is involved in chronic inflammatory diseases, cancer progression, and immune responses against infectious diseases . Osteopontin also co-stimulates T cell proliferation, further highlighting its importance in immune responses .

Applications

Recombinant human osteopontin is used in various research applications, including:

  • Cell culture: Suitable for studying cell adhesion, migration, and invasion assays .
  • Functional studies: Investigating the role of osteopontin in different physiological and pathological processes .
  • Biochemical assays: Used in SDS-PAGE, HPLC, and mass spectrometry analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

SPP1 Human
Osteopontin Human Recombinant
Cat. No.
BT25506
Source
Escherichia Coli.
SPP1 Mouse
Osteopontin 1 Mouse Recombinant
Cat. No.
BT25781
Source
<p><span lang="EN-US">HEK293 Cells.</span></p>
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.