PRL R Human

Prolactin Soluble Receptor Human Recombinant
Cat. No.
BT29760
Source
Escherichia Coli.
Synonyms
PRL-R, hPRLrI.
Appearance
Sterile filtered white lyophilized powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.
(c) Gel filtration at pH 8 under non denaturative conditions.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.
The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Product Specs

Introduction
Prolactin, a pituitary hormone, is crucial for milk production, salt and water balance, growth, development, and reproduction. Its action begins by binding to a specific membrane receptor, the prolactin receptor, a member of the class 1 cytokine receptor superfamily. Prolactin's diverse functions encompass ion transport, osmoregulation, milk and protein synthesis stimulation, and the regulation of various reproductive processes. It exerts its effects on different cell types through a signal transduction pathway initiated by binding to the transmembrane Prolactin receptor (PRLR). PRLR exhibits size variations (short and long forms) depending on tissue source and species, ranging from approximately 40 kDa to 100 kDa. The PRL-R structure consists of at least three distinct domains: an extracellular region with five cysteines containing the prolactin binding site, a single transmembrane domain, and a cytoplasmic region. The length of the cytoplasmic region influences ligand binding and cellular function regulation.
Description
The Extracellular Domain of the human Prolactin Receptor, recombinantly produced in E. coli, is a non-glycosylated polypeptide chain containing 210 amino acids with a molecular mass of 23.97 kDa. The Prolactin Receptor is purified using proprietary chromatographic techniques following the methods described by Bignon et al. (1994) JBC 269; 3318-24 and its activity is assessed as per Gertler et al. (1996) JBC 271; 24482-91.
Physical Appearance
Sterile filtered white powder.
Formulation
The Prolactin Receptor is lyophilized from a concentrated solution (0.4 mg/ml) containing 0.0045 mM NaHCO3.
Solubility
For reconstitution, it is recommended to dissolve the lyophilized PRLR in sterile 18 MΩ·cm H2O to a concentration of no less than 100 µg/ml and no more than 1 mg/ml. This solution can be further diluted with other aqueous solutions.
Stability
Lyophilized PRL-R, while stable at room temperature for 1-2 weeks, should be stored desiccated below -18 °C, or preferably at -80 °C, to prevent dimer formation. After reconstitution, PRL-R should be stored sterile at 4 °C for 2-7 days. For long-term storage, freezing at -18 °C or below is recommended. Adding a carrier protein (0.1% HSA or BSA) is advisable for storage at 4 °C. Repeated freeze-thaw cycles should be avoided as they can lead to protein oligomerization.
Purity
The purity is determined to be greater than 97.0% using the following methods: (a) SEC-HPLC analysis, (b) SDS-PAGE analysis, and (c) Gel filtration at pH 8 under non-denaturing conditions.
Biological Activity
The activity is assessed by the dose-dependent inhibition of Prolactin-stimulated proliferation of Nb2 cells and by high-affinity binding of ovine Prolactin and other lactogenic hormones in a 1:1 molar ratio.
Protein Content
Protein content is determined using UV spectroscopy at 280 nm, employing an absorbency value of 2.63 as the extinction coefficient for a 0.1% (1 mg/ml) solution. This value is calculated using the PC GENE computer analysis program for protein sequences (IntelliGenetics).
Synonyms
PRL-R, hPRLrI.
Source
Escherichia Coli.
Amino Acid Sequence
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH
FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL
WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR
CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.

Product Science Overview

Introduction

Prolactin is a pituitary hormone that plays a crucial role in various physiological processes, including milk production, salt and water regulation, growth, development, and reproduction. The primary mechanism of prolactin’s action involves binding to a specific membrane receptor known as the prolactin receptor (PRLR), which belongs to the superfamily of class 1 cytokine receptors .

Structure and Function

The prolactin receptor (PRLR) is a transmembrane protein that varies in size, ranging from approximately 40 kDa to 100 kDa, depending on the tissue source and species . The receptor consists of at least three distinct domains:

  1. Extracellular Region: Contains five cysteines and the prolactin binding site.
  2. Transmembrane Domain: A single domain that spans the cell membrane.
  3. Cytoplasmic Region: The length of this region influences ligand binding and regulates cellular function .
Prolactin Soluble Receptor (Human Recombinant)

The human recombinant prolactin soluble receptor (rHuPrl-R) is produced in Escherichia coli and is a non-glycosylated polypeptide chain containing 210 amino acids with a molecular mass of 23.97 kDa . This recombinant receptor is purified using proprietary chromatographic techniques and is typically provided as a sterile filtered white lyophilized powder .

Biological Activity

The activity of the prolactin soluble receptor is determined by its dose-dependent inhibition of prolactin-stimulated proliferation of Nb2 cells and by its high-affinity binding to ovine prolactin and other lactogenic hormones in a 1:1 molar ratio . This receptor plays a significant role in various biological processes, including ion transport, osmoregulation, protein synthesis, and the regulation of numerous reproductive functions .

Stability and Storage

The lyophilized prolactin receptor is stable at room temperature for 1-2 weeks but should be stored desiccated below -18°C or preferably at -80°C to prevent dimer formation . Upon reconstitution, the receptor should be stored sterile at 4°C for 2-7 days and for long-term storage below -18°C . It is recommended to add a carrier protein (0.1% HSA or BSA) for long-term storage at 4°C . Freeze-thaw cycles should be avoided as they cause oligomerization of the protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.