BNP Human

B-type Natriuretic Peptide Human
Cat. No.
BT19185
Source
Synonyms
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by RP-HPLC.
Usage

THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Shipped with Ice Packs
In Stock

Description

B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.

Product Specs

Introduction
B-type natriuretic peptide (BNP) is a cardiac hormone that exhibits diverse biological activities, including natriuresis, diuresis, vasorelaxation, and suppression of renin and aldosterone secretion. It is believed to be crucial in maintaining cardiovascular homeostasis by regulating the body's salt and water balance and improving heart function.
Description
Human B-type natriuretic peptide is a polypeptide composed of 32 amino acids, with a molecular weight of 3464 Daltons. Its molecular formula is C143H244N50O42S4.
Physical Appearance
Sterile filtered white lyophilized powder.
Formulation
The protein was lyophilized without the addition of any other substances.
Solubility
For reconstitution of the lyophilized B-type natriuretic peptide, it is recommended to use sterile 18MΩ-cm H2O at a concentration not less than 100µg/ml. The reconstituted solution can then be further diluted in other aqueous solutions.
Stability
Lyophilized B-type natriuretic peptide, while stable at room temperature for up to 3 weeks, should be stored in a dry environment below -18°C. After reconstitution, B-type natriuretic peptide should be stored at 4°C for 2-7 days. For long-term storage, it is recommended to store it below -18°C. The addition of a carrier protein (0.1% HSA or BSA) is advised for extended storage. Repeated freezing and thawing should be avoided.
Purity
The purity is determined to be greater than 95.0% using RP-HPLC.
Synonyms
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Amino Acid Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Product Science Overview

Introduction

B-type Natriuretic Peptide (BNP), also known as Brain Natriuretic Peptide, is a hormone produced by your heart. It plays a crucial role in cardiovascular homeostasis by regulating blood pressure and fluid balance. BNP is primarily synthesized in the ventricles of the heart and is released in response to ventricular volume expansion and pressure overload .

Discovery and Nomenclature

BNP was first discovered in the brain of pigs in 1988, which is why it was initially named Brain Natriuretic Peptide . However, subsequent research revealed that BNP is predominantly produced in the heart, particularly in the ventricles .

Synthesis and Secretion

BNP is synthesized as a pre-prohormone (pre-proBNP), which is then cleaved to form proBNP. ProBNP is further processed to produce the active hormone BNP and an inactive fragment known as NT-proBNP . The active BNP hormone consists of 32 amino acids and is responsible for its biological effects .

Biological Functions

BNP has several important physiological functions:

  • Natriuresis and Diuresis: BNP promotes the excretion of sodium and water by the kidneys, which helps to reduce blood volume and blood pressure .
  • Vasodilation: BNP causes the blood vessels to dilate, which decreases vascular resistance and lowers blood pressure .
  • Inhibition of the Renin-Angiotensin-Aldosterone System (RAAS): BNP inhibits the RAAS, which is a hormone system that regulates blood pressure and fluid balance .
  • Anti-fibrotic Effects: BNP has been shown to reduce fibrosis in the heart, which can help to prevent the progression of heart failure .
Clinical Significance

BNP and NT-proBNP levels are commonly measured in clinical practice to diagnose and manage heart failure. Elevated levels of these peptides are indicative of heart failure and can help to assess the severity of the condition . BNP testing is also used to monitor the effectiveness of treatment and to predict the prognosis of patients with heart failure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.