MOG Human

Myelin Oligodendrocyte Glycoprotein Human Recombinant
Cat. No.
BT14487
Source
Escherichia Coli.
Synonyms
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity

Greater than 95.0% as determined by SDS-PAGE.

Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Product Specs

Introduction
Myelin Oligodendrocyte Glycoprotein (MOG) is a cell surface protein primarily found on oligodendrocytes and the outer layer of myelin sheaths. Its location makes it a key target in immune responses that lead to demyelination. MOG plays a crucial role in myelin sheath formation, maintenance, and cell-to-cell communication. Studies have shown altered MOG expression levels in specific brain regions of patients with schizophrenia. Antibodies targeting MOG are essential for inducing experimental autoimmune encephalomyelitis (EAE) in mice, a model for studying multiple sclerosis.
Description
This product consists of a single, non-glycosylated polypeptide chain of Myelin Oligodendrocyte Glycoprotein (MOG) produced in E. coli. It contains 132 amino acids, including amino acids 30-154 of MOG and a 6x His tag at the C-terminus. The molecular weight of the protein is 15.2 kDa.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution containing 20mM HAc-NaAc and 150mM NaCl at a pH of 4.5.
Solubility
To reconstitute the lyophilized MOG, it is recommended to dissolve it in sterile 50mM Acetic acid at a concentration of at least 100µg/ml. The resulting solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized MOG remains stable at room temperature for up to 3 weeks. However, for long-term storage, it is recommended to store the lyophilized protein desiccated at temperatures below -18°C. After reconstitution, MOG can be stored at 4°C for 2-7 days. For extended storage, adding a carrier protein like HSA or BSA (0.1%) is advised. Avoid repeated freeze-thaw cycles.
Purity
The purity of this product is greater than 95.0% as determined by SDS-PAGE.
Synonyms
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
Source
Escherichia Coli.
Amino Acid Sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN
GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE
EAAMELKVEDPFYWVSPGHHHHHH.

Product Science Overview

Discovery and Structure

MOG was discovered approximately 30 years ago and has since become one of the most studied autoantigens in experimental autoimmune models for multiple sclerosis (MS) . The protein is encoded by the MOG gene in humans and is speculated to serve as an adhesion molecule, providing structural integrity to the myelin sheath . MOG is expressed late in the development of oligodendrocytes, making it an important marker for oligodendrocyte maturation .

Role in Disease

MOG is a potential target for cellular and humoral immune responses in inflammatory demyelinating diseases . Studies have shown that MOG antibodies can be found in a subset of patients with conditions such as acute disseminated encephalomyelitis (ADEM), neuromyelitis optica spectrum disorders (NMOSD), isolated optic neuritis (ON), transverse myelitis, atypical MS, and N-methyl-D-aspartate receptor-encephalitis with overlapping demyelinating syndromes . The presence of MOG antibodies is characterized by MS-typical demyelination and oligodendrocyte pathology associated with antibodies and complement .

Recombinant Human MOG

Recombinant human MOG (rhMOG) is produced for research purposes, particularly in studies involving experimental autoimmune encephalomyelitis (EAE), a model for CNS autoimmune demyelinating diseases . The production of rhMOG has been challenging due to its insolubility when overexpressed in bacterial cells. However, recent advancements have led to the development of protocols for high-yield production of soluble rhMOG in SHuffle cells, a commercially available E. coli strain engineered to facilitate disulfide bond formation in the cytoplasm . This method simplifies rhMOG production and enables further investigation of B cell-dependent EAE and human research of MOG in CNS demyelinating diseases .

Clinical Relevance

The clinical relevance of MOG antibodies has been a topic of debate. While MOG antibodies are transiently observed in monophasic diseases such as ADEM and their decline is associated with a favorable outcome, they are persistent in multiphasic ADEM, NMOSD, recurrent ON, or myelitis . The distinct clinical features within these diseases have led to discussions on whether MOG antibody-positive cases should be classified as a new disease entity .

In conclusion, Myelin Oligodendrocyte Glycoprotein (Human Recombinant) is a significant protein in the study of CNS autoimmune demyelinating diseases. Its role as a target for immune responses and its clinical relevance in various conditions make it a crucial area of research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.