MIG Human

MIG Human Recombinant (CXCL9)
Cat. No.
BT19564
Source
Escherichia Coli.
Synonyms

Small inducible cytokine B9, CXCL9, Gamma INF-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-INF.

Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

MIG (monokine induced by gamma-INF) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques.

Product Specs

Introduction

Chemokine (C-X-C motif) ligand 9, also known as CXCL9 or Monokine induced by gamma INF (MIG), is a small cytokine that belongs to the CXC chemokine family. This chemokine plays a role in attracting T-cells and is produced in response to IFN-γ stimulation. CXCL9 shares similarities with two other CXC chemokines, CXCL10 and CXCL11, both of which are located close to the CXCL9 gene on human chromosome 4. These three chemokines, CXCL9, CXCL10, and CXCL11, exert their chemotactic effects by interacting with the CXCR3 chemokine receptor.

Description

Recombinant Human MIG, produced in E. coli, is a single, non-glycosylated polypeptide chain. It consists of 103 amino acids, resulting in a molecular weight of 11.7 kDa. The purification process involves proprietary chromatographic techniques to ensure high purity.

Physical Appearance
The product appears as a sterile, white powder that has been lyophilized (freeze-dried).
Formulation
The product is lyophilized from a 0.2 µm filtered solution concentrated to 1.0 mg/ml in a buffer of 20mM PB, pH 7.4, with 50mM NaCl.
Solubility
To reconstitute the lyophilized MIG, it is recommended to dissolve it in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can then be further diluted into other aqueous solutions as needed.
Stability
Lyophilized MIG remains stable at room temperature for up to 3 weeks; however, it is recommended to store it desiccated at -18°C for long-term storage. Once reconstituted, CXCL9 should be stored at 4°C for up to 7 days. For extended storage, it is advisable to add a carrier protein like HSA or BSA at a concentration of 0.1%. Avoid repeated freeze-thaw cycles.
Purity
The purity of the product is greater than 97.0%, as determined by Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) and SDS-PAGE analysis.
Biological Activity
The biological activity of the product is determined through its chemoattractant properties on human peripheral blood T-lymphocytes. Using a concentration range of 10-100 ng/ml, the specific activity is found to be between 10,000 and 100,000 IU/mg.
Synonyms

Small inducible cytokine B9, CXCL9, Gamma INF-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-INF.

Source
Escherichia Coli.
Amino Acid Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDS
ADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Product Science Overview

Discovery and Cloning

CXCL9 was initially identified as a lymphokine-activated gene in mouse macrophages. Human CXCL9 was subsequently cloned using mouse MIG cDNA as a probe .

Structure and Expression

The recombinant human CXCL9 protein is typically expressed in E. coli and comprises 104 amino acids with a calculated molecular mass of approximately 11.9 kDa . It migrates as an approximately 16 kDa band in SDS-PAGE under reducing conditions .

Function

CXCL9 plays a crucial role in the immune system by affecting the growth, movement, or activation state of cells involved in immune and inflammatory responses. It functions as one of the three ligands for the chemokine receptor CXCR3, which is predominantly found on T cells . CXCL9, along with CXCL10 and CXCL11, activates CXCR3 by binding to it .

Role in Disease and Therapeutics

CXCL9 has been observed to be involved in T cell trafficking and is thought to play a role in various diseases, including cancer. Tumor endothelial cells secrete high levels of CXCL9 in melanoma metastases, suggesting a mechanism by which tumor cells might use the chemokine-expressing endothelium to form additional metastases at distinct sites .

Applications

Recombinant human CXCL9 is used in various research applications, including studies on immune response, inflammation, and cancer. It is available in different formulations, with or without carrier proteins like Bovine Serum Albumin (BSA), depending on the specific research needs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

MIG Bovine
MIG (CXCL9) Bovine Recombinant
Cat. No.
BT19487
Source
<p><span lang="EN-US">Escherichia Coli.</span></p>
MIG Human, His
MIG Human Recombinant (CXCL9), His Tag
Cat. No.
BT19643
Source
Escherichia Coli.
MIG Mouse
MIG Mouse Recombinant (CXCL9)
Cat. No.
BT19714
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.