IL17F Mouse
(b) Analysis by SDS-PAGE.
Description
The Mouse IL-17F is purified by proprietary chromatographic techniques.
Product Specs
WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR
EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.
Product Science Overview
Interleukin-17F (IL-17F) is a cytokine that belongs to the IL-17 family, which consists of six members: IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F. These cytokines play crucial roles in mediating proinflammatory responses and are involved in various immune and inflammatory processes. IL-17F, in particular, shares sequence similarity with IL-17A and is known for its involvement in inducing and mediating proinflammatory responses .
IL-17F is a glycosylated cytokine with a molecular mass of approximately 16.3 kDa. It is produced by activated T cells, specifically CD4+ T cells, and activated monocytes . The recombinant form of mouse IL-17F is typically expressed in human cells using a DNA sequence encoding the mouse IL-17F (Met1-Ala161) with a polyhistidine tag at the C-terminus .
IL-17F plays a significant role in the immune system by stimulating the production of other cytokines, such as IL-6 and IL-8. It is also involved in inhibiting angiogenesis of endothelial cells and inducing these cells to produce IL-2, TGF-β1, and monocyte chemoattractant protein-1 . Additionally, IL-17F is associated with allergic responses and has been shown to contribute to the pathogenesis of various inflammatory diseases.
Recombinant mouse IL-17F is produced using an expression system in human cells. The target protein is expressed with a sequence (Arg29-Ala161) of mouse IL-17F fused with a 6×His tag at the C-terminus . The recombinant protein is purified to a high degree of purity, typically greater than 95%, and is tested for endotoxin levels to ensure its suitability for research and therapeutic applications .
Recombinant mouse IL-17F is widely used in research to study its role in immune and inflammatory responses. It is also used to investigate the mechanisms underlying various inflammatory diseases and to develop potential therapeutic interventions targeting IL-17F-mediated pathways. The ability of recombinant IL-17F to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells in the presence of TNF-α is one of the key assays used to measure its biological activity .
