IL 13 Human

Interleukin-13 Human Recombinant
Cat. No.
BT30599
Source
Escherichia Coli.
Synonyms
NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.
The IL-13 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Interleukin 13 (IL-13) is a cytokine primarily produced by activated T helper 2 (Th2) cells, known for its role in regulating immune responses. IL-13 plays a crucial role in B cell development by promoting their maturation and differentiation. It enhances the expression of CD23 and MHC class II molecules on B cells while also driving their switch to IgE antibody production. Additionally, IL-13 suppresses macrophage activity, leading to decreased production of pro-inflammatory molecules like cytokines and chemokines. This cytokine is considered a key player in the development of allergic asthma, acting through mechanisms independent of IgE and eosinophils. The genes encoding IL-13, IL3, IL5, IL4, and CSF2 are clustered together on chromosome 5q, with IL-13 located in close proximity to IL4.
Description
Recombinant Human Interleukin-13, expressed in E. coli, is a single, non-glycosylated polypeptide chain. It consists of 112 amino acids, resulting in a molecular weight of 12 kDa. The purification process of IL-13 involves proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
The protein was lyophilized at a concentration of 1 mg/ml in a solution containing 1xPBS (pH 7.2) and 5% trehalose.
Solubility
To reconstitute the lyophilized Interleukin-13, it is recommended to dissolve it in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can then be further diluted into other aqueous solutions as needed.
Stability
Lyophilized Interleukin-13 demonstrates stability at room temperature for a period of 3 weeks. However, for optimal long-term storage, it is recommended to store the lyophilized product in a desiccated state at a temperature below -18°C. Upon reconstitution, IL-13 should be stored at 4°C for a period of 2 to 7 days. For extended storage, it is advisable to store it at temperatures below -18°C. To enhance stability during long-term storage, the addition of a carrier protein such as HSA or BSA (0.1%) is recommended. It's important to avoid repeated freeze-thaw cycles.
Purity
The purity of Interleukin-13 is determined using two methods: RP-HPLC analysis and SDS-PAGE analysis. The results confirm a purity greater than 95%.
Biological Activity
The biological activity of Interleukin-13 was assessed by measuring its ability to stimulate the proliferation of TF-1 cells. The ED50, which represents the concentration required to achieve half-maximal proliferation, was found to be less than 1 ng/ml. This corresponds to a specific activity exceeding 1 x 106 units/mg.
Protein Content
The protein content of Interleukin-13 is determined using two independent methods. The first method employs UV spectroscopy at 280 nm, utilizing an extinction coefficient of 0.57 for a 0.1% (1 mg/ml) solution. This value is derived from the analysis of protein sequences using the PC GENE computer analysis program (IntelliGenetics). The second method involves RP-HPLC analysis, comparing the sample to a calibrated solution of IL-13 as a reference standard.
Synonyms
NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Source
Escherichia Coli.
Amino Acid Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS
GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE
GRFN.

Product Science Overview

Introduction

Interleukin-13 (IL-13) is a cytokine produced primarily by T-helper type 2 (Tʜ2) cells, as well as by mast cells and natural killer (NK) cells . It plays a crucial role in the immune system, particularly in the regulation of inflammatory and immune responses. Recombinant human IL-13 is a synthetic form of this cytokine, produced using recombinant DNA technology, and is widely used in research and therapeutic applications.

Structure and Production

Human IL-13 is a protein consisting of 114 amino acid residues, with a molecular weight of approximately 12.5 kDa . The gene encoding IL-13 is located on chromosome 5q31 and comprises four exons and three introns . Recombinant human IL-13 is typically produced in Escherichia coli (E. coli) expression systems, which allow for high-yield production and easy purification .

Biological Functions

IL-13 shares structural and functional similarities with another cytokine, IL-4 . It binds to a receptor complex that includes the IL-13 receptor alpha 1 (IL-13Rα1) and the IL-4 receptor alpha (IL-4Rα), leading to the activation of signal transducer and activator of transcription 6 (STAT-6) . This signaling pathway is involved in various immune responses, including:

  • B cell activation and differentiation: IL-13 promotes B cell proliferation and isotype switching to immunoglobulin E (IgE), which is important in allergic responses .
  • Inhibition of monocyte and macrophage activation: IL-13 counteracts the effects of pro-inflammatory cytokines such as IL-1β, TNF-α, and IL-6, reducing inflammation .
  • Stimulation of NK cells and lymphokine-activated killer (LAK) cells: IL-13 enhances the cytotoxic activity of these cells, contributing to immune defense .
Therapeutic Applications

Recombinant human IL-13 is used in various research and clinical applications. It is employed in cell culture, differentiation studies, and functional assays to investigate its role in immune regulation and disease pathogenesis . Additionally, IL-13 has been studied as a potential therapeutic target for conditions such as asthma, where it plays a role in airway inflammation and remodeling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

IL 13 Rat
Interleukin-13 Rat Recombinant
Cat. No.
BT30691
Source
Escherichia Coli.
IL 13 Rat 109 a.a.
Interleukin-13 109 a.a. Rat Recombinant
Cat. No.
BT30736
Source
Escherichia Coli.
IL 13 Rhesus Macaque
Interleukin-13 Rhesus Macaque Recombinant
Cat. No.
BT30760
Source
Escherichia Coli.
IL 13 Variant Human
Interleukin-13 Variant Human Recombinant
Cat. No.
BT30794
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.