IL 1 alpha Human

Interleukin-1 alpha Human Recombinant
Cat. No.
BT28845
Source
Escherichia Coli.
Synonyms
Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.
The IL-1A is purified by proprietary chromatographic techniques.

Product Specs

Introduction

Interleukin-1 alpha (IL-1α) is a cytokine that plays a crucial role in the body's immune response. Primarily produced by activated macrophages, IL-1α stimulates the proliferation of thymocytes (immune cells in the thymus) by triggering the release of interleukin-2 (IL-2). Additionally, it contributes to the maturation and proliferation of B cells, which are responsible for producing antibodies. IL-1α also influences fibroblast growth factor activity, which is essential for tissue repair and wound healing. As a key player in the inflammatory response, IL-1α is recognized as an endogenous pyrogen, meaning it can induce fever. Furthermore, studies have shown that it can stimulate the production of prostaglandin, a hormone-like substance involved in inflammation and pain, from synovial cells found in joints.

Description
Recombinant human Interleukin-1 alpha, expressed in E. coli, is a non-glycosylated polypeptide chain consisting of 159 amino acids. This single-chain protein has a molecular weight of 18,022 Daltons. The purification of IL-1A is achieved using proprietary chromatographic methods.
Physical Appearance
The product appears as a sterile, white powder that has been lyophilized (freeze-dried).
Formulation
The protein was lyophilized from a sterile solution at a concentration of 1 mg/ml, containing 25 mM Tris-HCl buffer at a pH of 8.
Solubility
To reconstitute the lyophilized Interleukin-1 alpha, it is advised to dissolve it in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized Interleukin-1 alpha exhibits stability at room temperature for a period of 3 weeks. However, for long-term storage, it is recommended to store the desiccated product at temperatures below -18°C. After reconstitution, IL-1a should be stored at 4°C for a duration of 2 to 7 days. For extended storage, it is advisable to store it below -18°C. Repeated freeze-thaw cycles should be avoided.
Purity
The purity is determined to be greater than 97.0% through the following methods:
(a) Analysis using Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC).
(b) Analysis using Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE).
Biological Activity
The ED50, which represents the effective concentration required to achieve 50% of the maximum response, was determined to be less than 0.001 ng/ml in a murine D10S cell stimulation assay. This corresponds to a specific activity of 1 x 109 IU/mg.
Protein Content
Protein quantification was conducted using two independent methods:
1. UV spectroscopy at a wavelength of 280 nm, utilizing an absorbency value of 1.13 as the extinction coefficient for a 0.1% (1 mg/ml) solution. This value was calculated using the PC GENE computer analysis program for protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, employing a standard solution of IL-1 as a reference standard.
Synonyms
Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.
Source
Escherichia Coli.
Amino Acid Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Product Science Overview

Structure and Production

IL-1α is initially produced as a precursor protein, known as pro-IL-1α, which is then proteolytically processed to generate the mature form of the cytokine. The precursor form of IL-1α can also be biologically active and is often found on the cell surface of monocytes and B lymphocytes . The mature IL-1α protein consists of 159 amino acids and has a molecular weight of approximately 18 kDa .

Biological Functions

IL-1α is a pleiotropic cytokine, meaning it has multiple effects on different cell types. It is involved in various immune responses, including the activation of T cells and the promotion of the proliferation of fibroblasts. IL-1α also induces the production of other proinflammatory cytokines and mediators, such as tumor necrosis factor-alpha (TNF-α) and interleukin-6 (IL-6), which contribute to the inflammatory response .

One of the key roles of IL-1α is in the regulation of sterile inflammation, which occurs in the absence of pathogens. During tissue injury or necrosis, IL-1α is released and recruits immune cells to the site of injury, promoting the healing process . Additionally, IL-1α has been shown to contribute to angiogenesis, the formation of new blood vessels, during hypoxic conditions .

Recombinant IL-1α

Recombinant IL-1α is produced using recombinant DNA technology, where the IL-1α gene is inserted into an expression system, such as bacteria or yeast, to produce the protein in large quantities. The recombinant protein is then purified to achieve high levels of purity, typically greater than 95% . Recombinant IL-1α is used in various research applications, including studies on immune responses, inflammation, and cell proliferation .

Applications in Research

Recombinant IL-1α is widely used in immunological research to study its effects on different cell types and its role in various biological processes. It is used in cell culture experiments to investigate the proliferation and activation of immune cells, as well as in animal models to study the effects of IL-1α in vivo . Additionally, recombinant IL-1α is used in assays to measure the production of other cytokines and inflammatory mediators .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.