IGFBP3 Human
GH-dependant binding protein, IBP3, BP-53, IGFBP-3.
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Description
IGFBP3 Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 264 amino acids and having a molecular mass of 28806 Dalton.
IGFBP-3 is purified by proprietary chromatographic techniques.
Product Specs
Belonging to the IGFBP family, IGFBP3 is a protein encoded by the IGFBP3 gene. This protein features two domains: an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 interacts with IGFALS and either IGF-I or IGF-II to form a ternary complex, which circulates in the plasma. This complex formation serves to extend the half-life of IGFs and modify their interactions with cell surface receptors. Notably, different isoforms of IGFBP3 are produced through alternative transcriptional splicing.
Recombinant Human IGFBP3, expressed in E.Coli, is a non-glycosylated polypeptide chain. It comprises 264 amino acids, resulting in a molecular weight of 28806 Daltons. The purification of IGFBP-3 is achieved using proprietary chromatographic methods.
For reconstitution, it is advised to dissolve the lyophilized IGFBP3 in sterile 20mM acetic acid (AcOH) to a concentration of at least 100µg/ml. Subsequently, this solution can be diluted further into other aqueous solutions as needed.
(a) RP-HPLC analysis.
(b) SDS-PAGE analysis.
The ED50, determined by the ability of IGFBP3 to inhibit IGF-II-induced proliferation of MCF-7 cells, is less than 200ng/ml. This measurement was conducted in the presence of 15ng/ml Human IGF-II, resulting in a specific activity of 5.0 x 103 IU/mg.
GH-dependant binding protein, IBP3, BP-53, IGFBP-3.
GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGL
RCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSST
HRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN
HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Product Science Overview
The IGFBP3 gene is located on chromosome 7 at position 7p12.3 . The protein encoded by this gene consists of 264 amino acid residues and has a molecular weight of approximately 28.8 kDa . The recombinant human IGFBP3 (rhIGFBP3) is typically produced in host cells such as HEK293 cells and is often tagged with a polyhistidine tag for purification purposes .
IGFBP3 functions by binding to IGF-I and IGF-II with high affinity, thereby modulating their interaction with IGF receptors on the cell surface . This binding prolongs the half-life of IGFs in the circulation and regulates their bioavailability and activity . IGFBP3 also has IGF-independent roles, including the induction of apoptosis and inhibition of cell proliferation in various cancer cell lines .
Recombinant human IGFBP3 is widely used in research to study its role in cancer biology, endocrinology, and metabolic diseases. It is also used in functional assays to investigate its binding properties and biological activities . The protein’s ability to inhibit the biological activity of IGF-I and IGF-II makes it a valuable tool for understanding the IGF signaling pathway and its implications in disease .
