HCV Genotype 1b, 170 a.a.
Description
Product Specs
MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSSTNPKPQRKTKRNTNRRPQDV
KFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGWRQPIPKARRPEGRAW
AQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGF
ADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPVDKLAAALEHHHHHH*
Product Science Overview
Hepatitis C Virus (HCV) is a significant global health concern, affecting millions of individuals worldwide. The virus is classified into seven genotypes, with genotype 1 being the most prevalent and associated with severe liver diseases such as cirrhosis and hepatocellular carcinoma . The nucleocapsid (core) protein of HCV plays a crucial role in the virus’s life cycle, including the assembly and packaging of the viral RNA genome .
The HCV core protein is a highly conserved structural protein that forms the viral nucleocapsid. It is composed of 170 amino acids and is responsible for encapsulating the viral RNA . The core protein also interacts with various host cell factors, influencing viral replication and pathogenesis . The recombinant form of the HCV core protein, particularly from genotype 1b, has been extensively studied for its role in the virus’s life cycle and its potential as a target for therapeutic interventions .
Genotype 1b is one of the most common and clinically significant genotypes of HCV. It is associated with a higher risk of developing severe liver diseases and has been found to be less responsive to certain antiviral treatments compared to other genotypes . The core protein of genotype 1b has unique structural and functional properties that contribute to its pathogenicity and persistence in the host .
The recombinant form of the HCV core protein is produced using various expression systems, such as bacterial, yeast, and mammalian cells . This recombinant protein is used in research to study the virus’s structure, function, and interactions with host cells. It also serves as a valuable tool in the development of diagnostic assays and potential vaccines .
Research on the recombinant HCV core protein has provided significant insights into the virus’s biology and pathogenesis. Studies have shown that the core protein can modulate host immune responses, influence cell signaling pathways, and interact with other viral and host proteins . These findings have implications for the development of novel therapeutic strategies and vaccines targeting the core protein .
