GH Zebrafish

Growth Hormone Zebrafish Recombinant
Cat. No.
BT14757
Source
Escherichia Coli.
Synonyms
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 99.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Somatotropin Zebrafish Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21.18 kDa. The Zebrafish Recombinant is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Growth Hormone (GH) belongs to the somatotropin/prolactin hormone family, crucial for growth regulation. The GH gene resides within the growth hormone locus on chromosome 17, alongside four related genes, sharing a similar transcriptional orientation. This arrangement likely resulted from gene duplication events. These five genes exhibit significant sequence similarity. Alternative splicing further diversifies these growth hormones by generating additional isoforms, potentially leading to functional specialization. Notably, this specific family member expresses in the pituitary gland but not in placental tissues, contrasting with the other four genes in the growth hormone locus. Mutations or deletions in this gene can cause growth hormone deficiency, resulting in short stature.
Description
Recombinant Zebrafish Somatotropin, produced in E. coli, is a single, non-glycosylated polypeptide chain. It comprises 185 amino acids, including an additional alanine (Ala) at the N-terminus, and has a molecular weight of 21.18 kDa. Purification of the recombinant Zebrafish Somatotropin is achieved using proprietary chromatographic techniques.
Physical Appearance
The product appears as a sterile, filtered, white lyophilized (freeze-dried) powder.
Formulation
The protein was lyophilized from a concentrated solution (1 mg/mL) containing 0.5% sodium bicarbonate (NaHCO3) at pH 8.
Solubility
To reconstitute the lyophilized Zebrafish Growth Hormone, it is recommended to use a solution of 0.4% sodium bicarbonate (NaHCO3) or water adjusted to pH 9. The reconstitution concentration should be at least 100 µg/mL. This solution can be further diluted with other aqueous solutions, preferably containing a carrier protein like bovine serum albumin (BSA) or a similar agent.
Stability
Lyophilized Zebrafish Growth Hormone remains stable at room temperature for a minimum of two weeks. However, it is recommended to store the lyophilized product desiccated at a temperature below -18°C. Once reconstituted and sterilized by filtration, the GH solution can be stored at 4°C and pH 9 for up to four weeks. For long-term storage or when handling more diluted solutions, the addition of a carrier protein (0.1% human serum albumin (HSA) or BSA) is advised. Avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 99.0% using the following methods: (a) Size Exclusion Chromatography - High-Performance Liquid Chromatography (SEC-HPLC) analysis. (b) Sodium Dodecyl-Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) analysis.
Biological Activity
Zebrafish Growth Hormone exhibits biological activity in PDF-P1 3B9 cells, specifically those stably transfected with rabbit growth hormone receptors.
Synonyms
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Source
Escherichia Coli.
Amino Acid Sequence

AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL

SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS

TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL

PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL

Product Science Overview

Introduction

Growth hormone (GH), also known as somatotropin, is a peptide hormone that plays a crucial role in growth, metabolism, and development in vertebrates. In zebrafish (Danio rerio), recombinant growth hormone (GH) has been extensively studied for its potential applications in research, medicine, and aquaculture. This article provides a detailed overview of the background, production, and significance of growth hormone zebrafish recombinant.

Production of Zebrafish Recombinant Growth Hormone

Recombinant growth hormone is produced using genetic engineering techniques. In the case of zebrafish, the GH gene is cloned and expressed in a suitable host organism, such as Escherichia coli (E. coli). The recombinant protein is then purified using chromatographic techniques to obtain a high-purity product. The recombinant zebrafish GH is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional alanine at the N-terminus, resulting in a molecular mass of approximately 21.18 kDa .

Biological Functions of Growth Hormone in Zebrafish

Growth hormone in zebrafish regulates various physiological processes, including growth, metabolism, and reproduction. It exerts its effects by binding to specific GH receptors on target cells, leading to the activation of intracellular signaling pathways. These pathways promote cell proliferation, differentiation, and protein synthesis, ultimately contributing to somatic growth and development.

In addition to its role in growth, GH also influences metabolism by regulating the utilization of carbohydrates, lipids, and proteins. It enhances lipolysis, leading to the breakdown of fats, and stimulates gluconeogenesis, which is the production of glucose from non-carbohydrate sources. These metabolic effects are essential for maintaining energy homeostasis in zebrafish.

Applications of Zebrafish Recombinant Growth Hormone

The use of recombinant growth hormone in zebrafish has several important applications:

  1. Research: Zebrafish is a popular model organism in biomedical research due to its genetic similarity to humans and its transparent embryos, which allow for easy observation of developmental processes. Recombinant GH is used to study the effects of GH on growth, metabolism, and disease models in zebrafish. For example, researchers have investigated the role of GH in regulating hyperactivity-like behaviors in zebrafish, providing insights into potential therapeutic approaches for attention-deficit/hyperactivity disorder (ADHD) in humans .

  2. Medicine: Recombinant GH has potential therapeutic applications in treating growth disorders and metabolic diseases. By understanding the mechanisms of GH action in zebrafish, researchers can develop new strategies for managing conditions such as growth hormone deficiency and metabolic syndrome in humans.

  3. Aquaculture: The aquaculture industry benefits from the use of recombinant GH to enhance the growth and productivity of fish. Transgenic zebrafish expressing exogenous GH exhibit accelerated growth rates, improved feed conversion ratios, and increased body size compared to wild-type fish . These traits are desirable for commercial fish farming, as they can lead to higher yields and more efficient production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.