HGH Antibody

Growth Hormone Polyclonal Rabbit Anti Human Antibody
Cat. No.
BT5538
Source
Synonyms
GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin.
Appearance
Purity
Greater than 98%.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Product Specs

Introduction
Growth hormone (GH) is a member of the somatotropin/prolactin family of hormones that plays a crucial role in regulating growth. The GH gene, along with four other related genes, is located at the growth hormone locus on chromosome 17. These genes are arranged in the same transcriptional orientation, suggesting their evolution through gene duplication events. The five genes within this locus share a high degree of sequence identity. Alternative splicing further amplifies the diversity of growth hormones by generating additional isoforms, potentially leading to functional specialization. Notably, this specific family member is expressed in the pituitary gland but not in placental tissue, unlike the other four genes at the growth hormone locus. Mutations or deletions in the GH gene can result in growth hormone deficiency, leading to short stature.
Purity
Greater than 98%.
Formulation
Lyophilized from a sterile filtered (0.2 µm) solution containing phosphate buffered saline.
Solubility
Reconstitute the lyophilized pellet by adding distilled water at a 1:2 ratio (water:pellet) and allow it to dissolve completely.
Applications
ELISA: For indirect ELISA detection of HGH, a dilution of at least 1/1,000 of this antibody is recommended. This antibody, used in conjunction with compatible secondary reagents (e.g., anti-rabbit AP conjugated), enables the detection of HGH within a range of 0.2-1 ng/well. Western Blot: For Western blot analysis of HGH, this antibody can be used at a dilution of 1/1,500.
Stability
Store at -20°C. For long-term storage, it is recommended to freeze working aliquots at -20°C. Avoid repeated freezing and thawing cycles.
Synonyms
GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin.
Purification Method
Purified IgG prepared by affinity chromatography on protein G.
Type
Polyclonal Rabbit Antibody.
Immunogen
IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants.
Antigen Amino Acid Sequence
FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF

Product Science Overview

Introduction

Growth hormone (GH), also known as somatotropin, is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. It is crucial for human development and plays a significant role in maintaining tissue and organ health throughout life. The growth hormone polyclonal rabbit anti-human antibody is a vital tool in biomedical research, particularly in the study of growth hormone-related functions and disorders.

Production and Characteristics

Polyclonal antibodies are produced by immunizing an animal, in this case, a rabbit, with an antigen—in this context, human growth hormone. The rabbit’s immune system recognizes the human growth hormone as foreign and generates a diverse array of antibodies against it. These antibodies are then harvested from the rabbit’s serum.

The polyclonal nature of these antibodies means they consist of a mixture of immunoglobulin molecules that recognize multiple epitopes on the target antigen. This diversity can be advantageous in certain applications, as it increases the likelihood of detecting the antigen under various conditions.

Applications

The growth hormone polyclonal rabbit anti-human antibody is used in several scientific applications, including:

  1. Immunohistochemistry (IHC): This technique involves staining tissue sections to visualize the presence and localization of growth hormone within the tissues. It is particularly useful in studying the distribution and expression patterns of growth hormone in different tissues and under various physiological and pathological conditions .

  2. Western Blotting: This method is used to detect specific proteins in a sample. The antibody binds to the growth hormone, allowing researchers to identify and quantify the hormone in different samples .

  3. Enzyme-Linked Immunosorbent Assay (ELISA): This technique is used to measure the concentration of growth hormone in various biological samples. The polyclonal antibody’s ability to recognize multiple epitopes enhances the sensitivity and specificity of the assay .

  4. Immunoprecipitation: This method is used to isolate and concentrate growth hormone from a mixture of proteins. The polyclonal antibody binds to the growth hormone, allowing it to be separated from other proteins in the sample .

Advantages and Limitations

Advantages:

  • High Sensitivity: The ability to recognize multiple epitopes increases the likelihood of detecting the antigen.
  • Versatility: Suitable for various applications, including IHC, Western blotting, ELISA, and immunoprecipitation.
  • Cost-Effective: Generally less expensive to produce compared to monoclonal antibodies.

Limitations:

  • Batch Variability: Different batches of polyclonal antibodies can vary in their specificity and affinity, leading to potential inconsistencies in experimental results.
  • Cross-Reactivity: The presence of multiple antibodies increases the risk of cross-reactivity with other proteins, which can lead to non-specific binding and false-positive results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.