GH Rainbow Trout

Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant
Cat. No.
BT14028
Source
Escherichia Coli.
Synonyms
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity

Greater than 95.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.

Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton.
The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Growth hormone (GH) is a member of the somatotropin/prolactin family of hormones that play a crucial role in regulating growth. The GH gene, along with four other related genes, is located at the growth hormone locus on chromosome 17. These genes are arranged in the same transcriptional orientation, suggesting an evolutionary history of gene duplication. The five genes exhibit a high degree of sequence similarity. Alternative splicing generates additional isoforms of each of the five growth hormones, further increasing diversity and the potential for specialized functions. This particular GH isoform is expressed in the pituitary gland but not in placental tissue, unlike the other four genes in the growth hormone locus. Mutations or deletions in the GH gene can result in growth hormone deficiency and short stature.
Description
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is a single, non-glycosylated polypeptide chain produced in E. coli. It consists of 188 amino acids, with an additional alanine residue at the N-terminus, and has a molecular weight of 21,535 Daltons. The recombinant Rainbow Trout Growth Hormone is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
The protein was lyophilized from a concentrated (1 mg/ml) solution containing 0.5% sodium bicarbonate (NaHCO3) and adjusted to pH 8.
Solubility
To reconstitute the lyophilized Growth Hormone Rainbow Trout (Oncorhynchus mykiss), it is recommended to dissolve it in 0.4% NaHCO3 or water adjusted to pH 8-9. The initial reconstitution concentration should be at least 100 µg/ml but not exceeding 3 mg/ml. This solution can be further diluted with other aqueous solutions, preferably in the presence of a carrier protein like bovine serum albumin (BSA) or similar.
Stability
Lyophilized Growth Hormone Rainbow Trout (Oncorhynchus mykiss) remains stable at room temperature for a minimum of two weeks. However, it is recommended to store it desiccated at a temperature below -18°C. Once reconstituted and sterilized by filtration, the GH solution can be stored at 4°C and pH 9 for up to four weeks. For extended storage periods or more diluted solutions, the addition of a carrier protein (0.1% human serum albumin (HSA) or BSA) is recommended. Avoid repeated freeze-thaw cycles.
Purity
The purity is determined to be greater than 95% using the following methods: (a) Size-exclusion high-performance liquid chromatography (SEC-HPLC) analysis. (b) Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis.
Biological Activity
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant exhibits biological activity in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. However, its activity is approximately 10-fold lower compared to human GH.
Synonyms
GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Source
Escherichia Coli.
Amino Acid Sequence

AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVD
KHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLIT
GSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCR
KSLEANCTL.

Product Science Overview

Introduction

Growth hormone (GH) is a critical regulator of growth and metabolism in vertebrates, including fish. In aquaculture, the use of recombinant growth hormone has been explored to enhance growth rates and improve production efficiency. Rainbow trout (Oncorhynchus mykiss) is a species of significant economic importance in aquaculture, and the development of recombinant growth hormone for this species has been a focus of research.

Growth Hormone in Rainbow Trout

Growth hormone in rainbow trout is produced by the pituitary gland and plays a vital role in regulating growth, development, and metabolism. The hormone exerts its effects by binding to specific receptors on target tissues, initiating a cascade of signaling pathways that promote growth and protein synthesis. The primary pathways involved include the JAK-STAT, PI3K-Akt, and MAPK pathways .

Recombinant Growth Hormone

Recombinant growth hormone is produced using genetic engineering techniques. The gene encoding the growth hormone is inserted into a suitable expression system, such as bacteria or yeast, which then produces the hormone in large quantities. This recombinant hormone is purified and can be used to enhance growth in aquaculture species.

Applications in Aquaculture

The use of recombinant growth hormone in rainbow trout has shown promising results in terms of increased growth rates and improved feed efficiency. Studies have demonstrated that fish treated with recombinant growth hormone exhibit significantly higher growth rates compared to untreated controls . This can lead to shorter production cycles and increased yields, making aquaculture operations more efficient and profitable.

Mechanisms of Action

The mechanisms by which recombinant growth hormone enhances growth in rainbow trout involve several physiological processes. The hormone stimulates the production of insulin-like growth factor 1 (IGF-1) in the liver, which in turn promotes cell proliferation and protein synthesis in various tissues. Additionally, recombinant growth hormone enhances nutrient uptake and utilization, leading to improved growth performance .

Challenges and Considerations

While the use of recombinant growth hormone in aquaculture holds great potential, there are several challenges and considerations to address. These include ensuring the safety and efficacy of the hormone, understanding its long-term effects on fish health and the environment, and addressing regulatory and consumer acceptance issues. Ongoing research is focused on optimizing the use of recombinant growth hormone to maximize its benefits while minimizing potential risks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.