Greater than 95.0% as determined by:
(a) Analysis by SEC-HPLC.
(b) Analysis by SDS-PAGE.
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton.
The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVD
KHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLIT
GSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCR
KSLEANCTL.
Growth hormone (GH) is a critical regulator of growth and metabolism in vertebrates, including fish. In aquaculture, the use of recombinant growth hormone has been explored to enhance growth rates and improve production efficiency. Rainbow trout (Oncorhynchus mykiss) is a species of significant economic importance in aquaculture, and the development of recombinant growth hormone for this species has been a focus of research.
Growth hormone in rainbow trout is produced by the pituitary gland and plays a vital role in regulating growth, development, and metabolism. The hormone exerts its effects by binding to specific receptors on target tissues, initiating a cascade of signaling pathways that promote growth and protein synthesis. The primary pathways involved include the JAK-STAT, PI3K-Akt, and MAPK pathways .
Recombinant growth hormone is produced using genetic engineering techniques. The gene encoding the growth hormone is inserted into a suitable expression system, such as bacteria or yeast, which then produces the hormone in large quantities. This recombinant hormone is purified and can be used to enhance growth in aquaculture species.
The use of recombinant growth hormone in rainbow trout has shown promising results in terms of increased growth rates and improved feed efficiency. Studies have demonstrated that fish treated with recombinant growth hormone exhibit significantly higher growth rates compared to untreated controls . This can lead to shorter production cycles and increased yields, making aquaculture operations more efficient and profitable.
The mechanisms by which recombinant growth hormone enhances growth in rainbow trout involve several physiological processes. The hormone stimulates the production of insulin-like growth factor 1 (IGF-1) in the liver, which in turn promotes cell proliferation and protein synthesis in various tissues. Additionally, recombinant growth hormone enhances nutrient uptake and utilization, leading to improved growth performance .
While the use of recombinant growth hormone in aquaculture holds great potential, there are several challenges and considerations to address. These include ensuring the safety and efficacy of the hormone, understanding its long-term effects on fish health and the environment, and addressing regulatory and consumer acceptance issues. Ongoing research is focused on optimizing the use of recombinant growth hormone to maximize its benefits while minimizing potential risks .