GMFB Human
Glia Maturation Factor Beta Human Recombinant
Cat. No.
BT8965
Source
Escherichia Coli.
Synonyms
Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
(b) Analysis by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs 
In Stock 
Description
Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa.
Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
Product Specs
Introduction
Glia Maturation Factor-Beta (GMF-Beta), a 17 kDa protein, is a nerve growth factor recognized for its role in growth and differentiation within the vertebrate brain. This factor exhibits the ability to stimulate differentiation in both normal neurons and glial cells. Notably, GMF-Beta demonstrates an inhibitory effect on the proliferation of the N-18 neuroblastoma line and the C6 glioma line while simultaneously promoting their phenotypic expression. GMF-beta enhances the phenotypic expression of both glia and neurons, thereby inhibiting the proliferation of their respective tumor cells in cell cultures. While astrocytes produce and store GMF-b internally, they do not release it into the culture medium. GMFb acts on target cells in close proximity through cell-surface interactions. Produced by thymic epithelial cells, GMF-Beta plays a crucial role in T cell development, specifically favoring CD4+ T cells. As a brain-specific protein belonging to the actin-binding protein (ADF) family, GMF-beta appears to be involved in the differentiation, maintenance, and regeneration of the nervous system. Furthermore, it may contribute to the progression of certain autoimmune diseases, potentially due to its ability to induce the production and secretion of various pro-inflammatory cytokines.
Description
Recombinant Human Glia Maturation Factor-Beta (GMF-Beta) is produced in E. coli. It is a single, non-glycosylated polypeptide chain comprising 141 amino acids, resulting in a molecular mass of 16.5 kDa. The purification of Recombinant Human Glia Maturation Factor-Beta, GMF-Beta is achieved using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The GMF-beta protein solution was dialyzed against a buffer of 20mM PBS at pH 7.4 and 130mM NaCl before lyophilization.
Solubility
To reconstitute the lyophilized GMFB, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a concentration of at least 100 µg/ml. This solution can then be further diluted into other aqueous solutions as needed.
Stability
Lyophilized GMF-B, while stable at room temperature for up to 3 weeks, should be stored desiccated at a temperature below -18°C. After reconstitution, GMF-beta should be stored at 4°C for 2-7 days. For long-term storage, it is recommended to store it below -18°C. Adding a carrier protein, such as 0.1% HSA or BSA, is suggested for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
Purity exceeding 98.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Synonyms
Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Source
Escherichia Coli.
Amino Acid Sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPD
ELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
KLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
ELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
KLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
Product Science Overview
Introduction
Glia Maturation Factor Beta (GMFB) is a protein that plays a crucial role in the differentiation, maintenance, and regeneration of the nervous system. It belongs to the actin-binding proteins (ADF) structural family and is brain-specific . GMFB is encoded by the GMFB gene located on the long arm of human chromosome 14 .
Structure and Properties
Function
GMFB is involved in various cellular processes, including:
- Differentiation of Brain Cells: GMFB promotes the differentiation of glial cells and neurons, which are essential for the proper functioning of the nervous system .
- Neural Regeneration: It stimulates neural regeneration, aiding in the repair and recovery of damaged neural tissues .
- Inhibition of Tumor Cell Proliferation: GMFB has been shown to inhibit the proliferation of tumor cells, making it a potential target for cancer therapy .
Mechanism of Action
GMFB exerts its effects by binding to the Arp2/3 complex, which is involved in actin filament nucleation and branching . This interaction leads to actin filament debranching and negative regulation of Arp2/3 complex-mediated actin nucleation . These processes are critical for maintaining the structural integrity and function of cells, particularly in the nervous system.
Clinical Significance
GMFB has been implicated in various diseases and conditions, including:
- Glial Tumors: Abnormal expression of GMFB has been associated with the development of glial tumors .
- Osteoporosis in Type 1 Diabetes: GMFB deficiency has been shown to protect against diabetic osteoporosis by suppressing osteoclast hyperactivity . This finding suggests that GMFB could be a potential therapeutic target for treating osteoporosis in patients with type 1 diabetes .
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
