DKK3 Human, HEK
Dickkopf-Related Protein 3 Human Recombinant, HEK
Cat. No.
BT30495
Source
HEK293 cells.
Synonyms
Dickkopf 3 homolog (Xenopus laevis), dickkopf-related protein 3, regulated in glioma, RIG, RIG-like 7-1, RIG-like 5-6, Dkk-3, REIC.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs 
In Stock 
Description
DKK3 Human Recombinant is a single polypeptide chain containing 337 amino acids (22-350). DKK3 is fused to 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Product Specs
Introduction
Dickkopf-related protein 3 (DKK3) is a member of the DKK protein family, which also includes Dkk-1, 2, and 4. It is a secreted glycoprotein composed of 350 amino acids, featuring an N-terminal signal peptide and two conserved cysteine-rich domains connected by a 12-amino acid linker region. DKK3 plays a role in embryonic development by inhibiting the WNT signaling pathway. Notably, DKK3 gene expression is often downregulated in various cancer cell lines, suggesting it may act as a tumor suppressor gene.
Description
Recombinant Human DKK3 is a single polypeptide chain consisting of 337 amino acids (22-350). It is engineered with an 8-amino acid His-tag fused to the C-terminus and purified using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
DKK3 was lyophilized from a 0.2µM filtered solution containing 20mM PB and 150mM NaCl, at a pH of 7.2.
Solubility
To reconstitute lyophilized DKK3, it is recommended to dissolve it in 1xPBS to achieve a concentration of at least 100 µg/ml. This solution can be further diluted in other aqueous solutions as needed.
Stability
Lyophilized DKK3 remains stable at room temperature for up to 3 weeks. However, for long-term storage, it should be kept desiccated below -18°C. After reconstitution, DKK3 should be stored at 4°C for a period of 2-7 days. For future use, store below -18°C. Avoid repeated freeze-thaw cycles.
Purity
Purity is determined to be greater than 95% by SDS-PAGE analysis.
Synonyms
Dickkopf 3 homolog (Xenopus laevis), dickkopf-related protein 3, regulated in glioma, RIG, RIG-like 7-1, RIG-like 5-6, Dkk-3, REIC.
Source
HEK293 cells.
Amino Acid Sequence
APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAA
KASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVG
DEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHC
TKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLIT
WELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVG
SFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEIVDHHHHHH.
KASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVG
DEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHC
TKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLIT
WELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVG
SFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEIVDHHHHHH.
Product Science Overview
Structure and Composition
DKK3 is a secreted glycoprotein composed of 350 amino acids. It features an N-terminal signal peptide and two conserved cysteine-rich domains separated by a 12 amino acid linker region . The human recombinant form of DKK3, produced in HEK293 cells, is a single polypeptide chain containing 337 amino acids (22-350) and is fused to an 8 amino acid His-tag at the C-terminus .
Biological Function
DKK3 plays a significant role in embryonic development by inhibiting the WNT signaling pathway. This pathway is essential for various cellular processes, including cell fate determination, cell migration, and organogenesis. By modulating this pathway, DKK3 helps regulate the proper formation and differentiation of tissues during development .
Clinical Significance
Recombinant Production
Physical and Chemical Properties
- Formulation: DKK3 is lyophilized from a 0.2µM filtered solution of 20mM phosphate buffer (PB) and 150mM sodium chloride (NaCl), pH 7.2 .
- Solubility: It is recommended to reconstitute the lyophilized DKK3 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions .
- Stability: Lyophilized DKK3 is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term storage. Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for future use. Freeze-thaw cycles should be avoided to maintain protein integrity .
- Purity: The recombinant DKK3 protein has a purity greater than 95% as determined by SDS-PAGE .
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
