CD14 Human HEK

CD14 Human Recombinant HEK
Cat. No.
BT25520
Source
HEK293 cells.
Synonyms
Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Product Specs

Introduction
CD14, also known as the lipopolysaccharide (LPS) receptor, is primarily found on monocytes and macrophages, with weak expression on neutrophils. This protein is attached to the cell surface via a glycosylphosphatidylinositol (GPI) anchor. CD14 acts as a high-affinity receptor for complexes formed by LPS and LPS binding protein (LBP). Soluble CD14 can also bind LPS, acting as an agonist at physiological concentrations and as an antagonist at higher concentrations in cell activation processes. Furthermore, CD14 has been observed to bind to apoptotic cells.
Description
Recombinant human CD14, produced in a mammalian expression system using human cells, is a single polypeptide chain consisting of 341 amino acids (20-352). It includes an 8 amino acid His-tag fused at the C-terminus and is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile filtered white lyophilized (freeze-dried) powder.
Formulation
CD14 was lyophilized from a 0.2 µM filtered solution containing 20mM PB and 150mM NaCl, at a pH of 7.4.
Solubility
For reconstitution, it is recommended to dissolve the lyophilized CD14 in 1xPBS to a minimum concentration of 100 µg/ml. This solution can be further diluted with other aqueous solutions as needed.
Stability
Lyophilized CD14 remains stable at room temperature for up to 3 weeks. However, for long-term storage, it should be kept desiccated at a temperature below -18°C. After reconstitution, CD14 should be stored at 4°C for a period of 2-7 days. For extended storage, it should be kept at a temperature below -18°C. Avoid repeated freeze-thaw cycles.
Purity
Purity is greater than 95% as determined by SDS-PAGE analysis.
Synonyms
Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
Source
HEK293 cells.
Amino Acid Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVD
ADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKIT
GTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAF
SCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCA
ALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKL
RVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH

Product Science Overview

Recombinant Human CD14

Recombinant human CD14 is a form of the protein that is produced using recombinant DNA technology. This involves inserting the gene that encodes CD14 into a host cell, such as HEK293 cells (Human Embryonic Kidney 293 cells), which then express the protein. The recombinant protein can be purified and used for various research and therapeutic purposes.

Expression in HEK293 Cells

HEK293 cells are commonly used for the production of recombinant proteins due to their high transfection efficiency and ability to perform post-translational modifications. Recombinant human CD14 expressed in HEK293 cells is typically of high purity (>95%) and low endotoxin levels (<1 EU/µg), making it suitable for various applications such as SDS-PAGE, functional assays, and HPLC .

Biological Properties and Functions

CD14 is involved in the innate immune response by recognizing and binding to LPS, which triggers a signaling cascade that leads to the activation of the NF-κB pathway. This results in the production of pro-inflammatory cytokines and other immune responses. The recombinant form of CD14 retains its biological activity and can be used to study these signaling pathways in vitro .

Applications

Recombinant human CD14 is used in various research applications, including:

  • Studying TLR4 Signaling: CD14 acts as a co-receptor with TLR4 (Toll-like receptor 4) in the recognition of LPS. Researchers use recombinant CD14 to investigate the mechanisms of TLR4 signaling and its role in immune responses .
  • Drug Screening: It is used in high-throughput screening assays to identify potential drugs that can modulate the immune response by targeting CD14 or its associated pathways.
  • Therapeutic Research: Recombinant CD14 is explored as a potential therapeutic agent for conditions involving excessive inflammation, such as sepsis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

CD14 Human
CD14 Human Recombinant
Cat. No.
BT25442
Source
E.coli.
CD14 Human, CHO
CD14 Human Recombinant, CHO
Cat. No.
BT25617
Source
CHO-cells.
CD14 Mouse
CD14 Mouse Recombinant
Cat. No.
BT25705
Source
CHO-cells.
CD14 Mouse, Sf9
CD14 Mouse Recombinant, Sf9
Cat. No.
BT25791
Source
Sf9, Baculovirus cells.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.