TARC Human

Thymus & Activation Regulated Chemokine Human Recombinant (CCL17)
Cat. No.
BT24577
Source
Escherichia Coli.
Synonyms
C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

CCL17 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa.
The TARC is purified by proprietary chromatographic techniques.

Product Specs

Introduction
TARC cDNA encodes a precursor protein composed of 94 amino acids, including a 23 amino acid signal peptide. This signal peptide is cleaved to produce the mature secreted protein, which consists of 71 amino acids. TARC shares approximately 24-29% amino acid sequence identity with other CC chemokine family members, such as RANTES, MIP-1a, MIP-1b, MCP-1, MCP-2, MCP-3, and I-309. Expression of TARC is observed in the thymus, with lower levels detected in the lung, colon, and small intestine. Transient expression of TARC is also seen in stimulated peripheral blood mononuclear cells. Recombinant TARC exhibits chemotactic activity towards T cell lines but not monocytes or neutrophils. CCL-17, another name for TARC, functions as a specific ligand for CCR4, a receptor primarily found on T cells. CCL17 is one of several Cys-Cys (CC) cytokine genes located on the q arm of chromosome 16. CCL17 demonstrates chemotactic activity for T lymphocytes but not monocytes or granulocytes. It binds to chemokine receptors CCR4 and CCR8. This chemokine plays a crucial role in T cell development within the thymus and in the trafficking and activation of mature T cells.
Description
Recombinant CCL17 Human, produced in E. coli, is a single, non-glycosylated polypeptide chain consisting of 71 amino acids. It has a molecular mass of 8 kDa. The TARC protein undergoes purification using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The protein was lyophilized from a concentrated (0.5 mg/mL) solution containing 20 mM PBS and 150 mM NaCl at a pH of 7.4.
Solubility
To reconstitute the lyophilized CCL17, it is recommended to dissolve it in sterile 18 MΩ-cm H2O at a concentration of at least 100 µg/mL. This solution can be further diluted in other aqueous solutions.
Stability
Lyophilized TARC remains stable at room temperature for three weeks; however, it is recommended to store it desiccated below -18°C. After reconstitution, store TARC at 4°C for 2-7 days. For long-term storage, keep it below -18°C. The addition of a carrier protein (0.1% HSA or BSA) is advisable for long-term storage. Avoid freeze-thaw cycles.
Biological Activity
The biological activity is determined by the protein's ability to chemoattract human T-lymphocytes. This is measured using a concentration range of 1.0-10.0 ng/mL, corresponding to a specific activity of 1,000,000-10,000,000 IU/mg.
Purity
The purity is greater than 97.0% as determined by (a) RP-HPLC analysis and (b) SDS-PAGE analysis.
Synonyms
C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.
Source
Escherichia Coli.
Amino Acid Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.

Product Science Overview

Introduction

Thymus and Activation Regulated Chemokine (TARC), also known as CCL17, is a chemokine that plays a crucial role in the immune system. It is produced by the thymus and various antigen-presenting cells, including dendritic cells, macrophages, and monocytes . CCL17 is involved in the chemotaxis of T-helper cells, particularly type 2 helper T cells (Th2), and is significant in various immune responses .

Gene and Protein Structure

The CCL17 gene is located on chromosome 16 in humans . The protein encoded by this gene is a member of the CC chemokine family, characterized by two adjacent cysteines near their amino terminus . The structure of CCL17 allows it to bind to specific receptors on the surface of target cells, facilitating its role in immune cell signaling and migration .

Function and Mechanism

CCL17 functions primarily by binding to the CCR4 receptor, which is expressed on Th2 cells, regulatory T cells, and other immune cells . This binding induces chemotaxis, guiding these cells to sites of inflammation or immune response . CCL17 is constitutively produced in the thymus and can be upregulated in response to certain stimuli, such as phytohemagglutinin-stimulated peripheral blood mononuclear cells .

Role in Diseases

CCL17 has been implicated in various diseases, particularly those involving immune dysregulation. It plays a complex role in cancer, where it can attract T-regulatory cells, allowing some cancers to evade the immune response . Conversely, in other cancers like melanoma, increased levels of CCL17 are associated with improved outcomes . Additionally, CCL17 is linked to autoimmune and allergic diseases, where it contributes to the recruitment of immune cells to affected tissues .

Clinical Relevance

The clinical relevance of CCL17 extends to its potential as a diagnostic and therapeutic target. Elevated levels of CCL17 can indicate certain eosinophilic disorders and other immune-related conditions . Understanding the regulation and function of CCL17 can aid in developing treatments for diseases characterized by immune cell infiltration and inflammation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.