AHSG Human HEK
Description
Product Specs
Fetuin, a negative acute phase protein synthesized in the liver, consists of two subunits: A and B. Homologs of fetuin have been discovered in various species, including humans, rodents, sheep, pigs, rabbits, guinea pigs, cattle, and mice. These homologs have been implicated in multiple physiological functions, such as their ability to bind hydroxyapatite crystals and inhibit the tyrosine kinase activity of the insulin receptor. Fetuin-A, also known as alpha2-Heremans-Schmid glycoprotein (AHSG), acts as a circulating inhibitor of calcification in vivo and its levels decrease during acute-phase responses. Studies have shown that serum from patients undergoing long-term dialysis, who typically have low AHSG concentrations, exhibits a reduced capacity to inhibit calcium phosphate precipitation outside the body. Furthermore, fetuin is believed to play a role in resolving inflammation by regulating the process of apoptotic cell phagocytosis by macrophages. ASHG has been found to block TGF-beta signaling pathways in osteoblasts, and mice deficient in ASHG exhibit abnormalities in growth plate development, increased bone formation with age, and enhanced cytokine-induced osteogenesis.
Avoid repeated freeze-thaw cycles.
IDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRK
VCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTD
CVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTP
VVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSH
PRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH.
Product Science Overview
Alpha-2-HS-Glycoprotein consists of two polypeptide chains, which are cleaved from a single proprotein encoded by a single mRNA . The mature circulating form of this protein is composed of these two chains . The recombinant form, produced in human embryonic kidney (HEK) cells, is a single polypeptide chain containing 357 amino acids .
This glycoprotein is involved in several critical functions:
- Endocytosis: It promotes the internalization of substances into cells .
- Brain Development: It is present in the cortical plate of the immature cerebral cortex, suggesting a role in brain development .
- Bone Tissue Formation: It influences the mineral phase of bone and is involved in the regulation of bone mineralization .
Additionally, Alpha-2-HS-Glycoprotein has opsonic properties, meaning it can enhance the immune system’s ability to target and eliminate pathogens . It also shows affinity for calcium and barium ions, which is crucial for its role in bone metabolism .
Alpha-2-HS-Glycoprotein is implicated in various biological processes, including:
- Regulation of Bone Mineralization: It negatively regulates bone mineralization, ensuring proper bone formation and maintenance .
- Acute-Phase Response: It is involved in the body’s acute-phase response to inflammation .
- Regulation of Insulin Receptor Signaling Pathway: It negatively regulates this pathway, impacting glucose metabolism .
- Phagocytosis and Pinocytosis: It positively regulates phagocytosis (the engulfing of particles by cells) and pinocytosis (the ingestion of liquid into cells) .
Due to its involvement in numerous physiological processes, Alpha-2-HS-Glycoprotein is a subject of interest in various medical research fields. Its role in bone metabolism makes it a potential target for osteoporosis treatment. Additionally, its regulatory effects on insulin signaling pathways suggest its relevance in diabetes research .
