TGFB3 Antibody
Transforming Growth Factor-beta3, TGFB3, ARVD, FLJ16571, TGF-beta3.
Description
Product Specs
Transforming Growth Factor-beta3, TGFB3, ARVD, FLJ16571, TGF-beta3.
LGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Product Science Overview
Transforming Growth Factor-beta 3 (TGF-β3) is a member of the Transforming Growth Factor-beta (TGF-β) family, which plays a crucial role in regulating cellular processes such as proliferation, differentiation, and apoptosis. TGF-β3 is particularly significant in embryonic development and tissue regeneration. The polyclonal rabbit anti-human antibody against TGF-β3 is a valuable tool in research for detecting and studying this protein.
TGF-β3 is one of the three isoforms of TGF-β found in mammals, the others being TGF-β1 and TGF-β2. These isoforms are involved in various cellular functions and are known for their ability to mediate cell-cell interactions during embryonic development. TGF-β3, in particular, has been implicated in the development of the palate, lungs, and heart, as well as in wound healing and scar formation.
Polyclonal antibodies are produced by immunizing an animal (in this case, a rabbit) with an antigen, which in this context is the TGF-β3 protein. The immune system of the rabbit generates a diverse array of antibodies that recognize multiple epitopes on the antigen. This diversity makes polyclonal antibodies highly sensitive and capable of detecting the target protein in various applications.
The production of polyclonal rabbit anti-human TGF-β3 antibody involves several steps:
- Immunization: Rabbits are immunized with the human TGF-β3 protein or a peptide derived from it. This process involves multiple injections over a period to ensure a robust immune response.
- Serum Collection: After a sufficient immune response is achieved, blood is collected from the rabbits. The serum, which contains the antibodies, is separated from the blood cells.
- Purification: The antibodies are purified from the serum using techniques such as affinity chromatography. This step ensures that the final product is highly specific to TGF-β3.
The polyclonal rabbit anti-human TGF-β3 antibody is used in various research applications, including:
- Western Blotting (WB): To detect TGF-β3 protein in cell or tissue lysates.
- Immunohistochemistry (IHC): To visualize the localization of TGF-β3 in tissue sections.
- Immunofluorescence (IF): To study the distribution of TGF-β3 within cells using fluorescently labeled secondary antibodies.
- Enzyme-Linked Immunosorbent Assay (ELISA): To quantify the levels of TGF-β3 in biological samples.
