TGFB2 Human
Description
Product Specs
EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS
PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
Product Science Overview
Transforming Growth Factor Beta 2 (TGF-β2) is a member of the Transforming Growth Factor Beta (TGF-β) family, which is a superfamily of growth factors involved in regulating various biological processes such as cell growth, proliferation, differentiation, and apoptosis . TGF-β2 is a secreted protein that plays a crucial role in immune homeostasis, balancing lymphocyte proliferation, apoptosis, hematopoiesis, and embryogenesis .
TGF-β2 is known for its diverse biological functions. It acts as a strong growth inhibitor for normal and transformed epithelial, lymphoid, fibroblast, and keratinocyte cells . Additionally, TGF-β2 inhibits antigen-induced T cell proliferation, epithelial cell proliferation, and induces mesenchymal cell proliferation . It also has cell-specific effects on apoptosis, making it a key player in maintaining cellular homeostasis .
TGF-β2 is produced by various cell types, including eosinophils, astrocytes, glioblastoma, and other cancer-derived cell types . The TGF-β signaling cascade is initiated by the binding of mature ligands to corresponding receptors on the cell surface, forming a complex that activates Smad or non-Smad molecules to transduce signals into the nucleus and regulate the expression of target genes .
Recombinant Human TGF-β2 is produced using recombinant DNA technology, which involves inserting the gene encoding TGF-β2 into a suitable expression system, such as a mouse myeloma cell line . The recombinant protein is then purified to achieve high purity levels, typically greater than 97% . Recombinant TGF-β2 is used in various research applications, including studying its effects on cell proliferation, differentiation, and apoptosis.
Recombinant Human TGF-β2 is widely used in research to study its role in various biological processes and diseases. It is particularly important in the development of cardiac, lung, craniofacial, limb, eye, ear, and urogenital systems . Additionally, dysregulation of TGF-β2 signaling has been associated with tumorigenesis, eye diseases, cardiovascular diseases, immune disorders, and motor system diseases .
