TGFB2 Antibody

Transforming Growth Factor-beta 2 Polyclonal Rabbit Anti Human Antibody
Cat. No.
BT6036
Source
Synonyms
Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 98%.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Product Specs

Introduction
Transforming growth factor beta 2 (TGFB2) is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains connected by a single disulfide bond. It belongs to a family of five related cytokines that exhibit diverse effects on normal and cancerous cells, highlighting their significance as multifunctional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFβ1, TGFβ2, and TGFβ3) share a common signaling pathway and elicit similar biological responses. They play crucial roles in various physiological processes, including embryogenesis, tissue remodeling, and wound healing.
Physical Appearance
Sterile Filtered White lyophilized powder.
Purity
Greater than 98%.
Formulation
Lyophilized from a sterile filtered (0.2 µm) solution containing phosphate buffered saline.
Solubility
To reconstitute, add distilled water at a 1:2 ratio (water:lyophilized powder) and allow the lyophilized pellet to dissolve completely.
Applications
Western Blot: This antibody can be used at a dilution of 1:1,000 for the detection of human TGFβ2 by Western Blot analysis.
Stability
Store at -20°C. For long-term storage, aliquot into working volumes and freeze at -20°C. Repeated freezing and thawing is not recommended.
Synonyms
Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Purification Method
Purified IgG prepared by affinity chromatography on protein G.
Type
Polyclonal Rabbit Antibody.
Immunogen
IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.
Antigen Amino Acid Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Product Science Overview

Introduction

Transforming Growth Factor-beta 2 (TGF-β2) is a member of the TGF-β family, which plays a crucial role in regulating various cellular processes, including cell growth, differentiation, and immune responses. The TGF-β family is known for its involvement in embryonic development, tissue homeostasis, and the pathogenesis of various diseases, including cancer and fibrosis.

Transforming Growth Factor-beta 2 (TGF-β2)

TGF-β2 is a multifunctional cytokine that is involved in the regulation of cell proliferation, differentiation, and apoptosis. It is produced by various cell types, including immune cells, epithelial cells, and fibroblasts. TGF-β2 signals through a receptor complex composed of type I and type II serine/threonine kinase receptors, leading to the activation of intracellular signaling pathways that modulate gene expression.

Polyclonal Rabbit Anti Human Antibody

Polyclonal antibodies are produced by immunizing animals, such as rabbits, with an antigen, in this case, TGF-β2. The immune system of the rabbit generates a diverse population of antibodies that recognize multiple epitopes on the TGF-β2 protein. These antibodies are then collected from the rabbit’s serum and purified for use in various research applications.

Production and Purification

The production of polyclonal rabbit anti-human TGF-β2 antibody involves several steps:

  1. Immunization: Rabbits are immunized with a synthetic peptide corresponding to a specific region of the human TGF-β2 protein. This peptide acts as an immunogen, stimulating the rabbit’s immune system to produce antibodies against TGF-β2.
  2. Serum Collection: After a series of booster immunizations, blood is collected from the rabbits, and the serum is separated from the blood cells.
  3. Antibody Purification: The serum contains a mixture of antibodies, including those specific to TGF-β2. These antibodies are purified using techniques such as protein A/G affinity chromatography, which selectively binds to the Fc region of the antibodies, allowing for their isolation from other serum proteins.
Applications

The polyclonal rabbit anti-human TGF-β2 antibody is widely used in various research applications, including:

  • Western Blotting: To detect and quantify TGF-β2 protein levels in cell and tissue lysates.
  • Immunohistochemistry (IHC): To visualize the localization and distribution of TGF-β2 in tissue sections.
  • Enzyme-Linked Immunosorbent Assay (ELISA): To measure TGF-β2 concentrations in biological samples, such as serum or cell culture supernatants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.