Protein G

Protein G Recombinant
Cat. No.
BT9299
Source
Escherichia Coli.
Synonyms
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
>96% as determined by SDS-PAGE and RP-HPLC.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.

Product Specs

Description
Protein G is a single, non-glycosylated protein composed of 200 amino acids with a molecular weight of 21.8kDa. On SDS-PAGE, it migrates at approximately 32kDa.
Physical Appearance
White, sterile-filtered lyophilized powder.
Formulation
The product is provided as a lyophilized white powder without any additives.
Solubility
It can be reconstituted using deionized water or PBS.
Stability
Lyophilized Recombinant Protein G, while stable at room temperature for up to 3 weeks, should be stored in a dry state below -18°C. After reconstitution, it should be kept at 4°C for 2-7 days. For long-term storage, store below -18°C. Avoid repeated freeze-thaw cycles.
Purity
The purity is greater than 96% as determined by SDS-PAGE and RP-HPLC.
Source
Escherichia Coli.
Amino Acid Sequence

LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.

Product Science Overview

Structure and Characteristics

Protein G is a cell surface protein that exists in different molecular forms, typically around 60 kDa in size. The native form of Protein G also binds to albumin, but this binding site has been removed in recombinant versions to reduce non-specific binding . Recombinant Protein G is often expressed in Escherichia coli (E. coli) and can be modified with tags such as polyhistidine (His) for easier purification and detection .

Binding Specificity

Protein G has a high affinity for the Fc region of IgG antibodies from various species, including humans, rabbits, and mice. This binding specificity makes it particularly useful for purifying antibodies from complex mixtures and for detecting antibodies in various assays .

Applications
  1. Antibody Purification: Protein G is widely used to purify IgG antibodies from serum, cell culture supernatants, and other sources. The recombinant form, which lacks the albumin-binding site, ensures higher purity of the isolated antibodies .
  2. Immunoprecipitation: Protein G is used to precipitate antigen-antibody complexes, allowing researchers to isolate and study specific proteins from a mixture.
  3. Immunofluorescence and Super-Resolution Imaging: Recombinant Protein G, labeled with fluorophores or single-stranded DNA, can replace secondary antibodies in imaging techniques, providing more precise and specific detection .
Advantages of Recombinant Protein G
  • Reduced Non-Specific Binding: The removal of the albumin-binding site in recombinant Protein G minimizes non-specific interactions, leading to cleaner results in antibody purification and detection .
  • High Purity and Stability: Recombinant Protein G is typically produced with high purity (>98%) and can be stored for extended periods without significant loss of activity .
  • Versatility: The ability to modify recombinant Protein G with various tags and labels enhances its utility in different experimental setups .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.