The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Protein G is a cell surface protein that exists in different molecular forms, typically around 60 kDa in size. The native form of Protein G also binds to albumin, but this binding site has been removed in recombinant versions to reduce non-specific binding . Recombinant Protein G is often expressed in Escherichia coli (E. coli) and can be modified with tags such as polyhistidine (His) for easier purification and detection .