OTOR Human

Otoraplin Human Recombinant
Cat. No.
BT19970
Source
Escherichia Coli.
Synonyms
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.
The OTOR is purified by proprietary chromatographic techniques.

Product Specs

Introduction
OTOR proteins, also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL), belong to the melanoma-inhibiting activity gene family. Expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes, Otoraplin is a secreted 16 kDa globular protein. OTOR shares significant homology with MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), a cartilage-specific protein also found in malignant melanoma cells. Mature human otoraplin consists of 111 amino acids, including one SH3 domain (amino acids 46-107) and a Tyr at position 50 that is believed to be sulfated. Otoraplin plays a crucial role in initiating periotic mesenchyme chondrogenesis. It is secreted via the Golgi apparatus and contributes to cartilage development and maintenance. Polymorphisms in the OTOR translation start codon are frequent and can halt translation, potentially leading to deafness.
Description
Recombinant Human Otoraplin, produced in E. coli, is a single, non-glycosylated polypeptide chain comprising 111 amino acids. It has a molecular weight of 12.7 kDa. OTOR is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized powder.
Formulation
The OTOR protein was lyophilized from a concentrated solution (1 mg/mL) in 20 mM PBS (pH 7.4) and 130 mM NaCl.
Solubility
To reconstitute the lyophilized Otoraplin, it is recommended to dissolve it in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/mL. Further dilutions can be made in other aqueous solutions.
Stability
Lyophilized OTOR Recombinant, though stable at room temperature for up to 3 weeks, should be stored desiccated at or below -18°C. After reconstitution, OTOR should be stored at 4°C for 2-7 days. For long-term storage, it is recommended to store at -18°C. Adding a carrier protein (0.1% HSA or BSA) is recommended for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
Greater than 98.0% as determined by (a) RP-HPLC analysis and (b) SDS-PAGE analysis.
Synonyms
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Source
Escherichia Coli.
Amino Acid Sequence
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS
KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTT
DIDFFCE.

Product Science Overview

Expression and Function

Otoraplin is predominantly expressed in the cochlea of the inner ear and to a lesser extent in the fetal brain and some cartilage tissues . It plays a crucial role in early chondrogenesis of the otic capsule, which is essential for normal inner ear development and auditory function . Additionally, Otoraplin is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), a cartilage-specific protein also expressed in malignant melanoma cells .

Structure

The mature human Otoraplin consists of 111 amino acids and contains one SH3 domain (amino acids 46-107). It also has a tyrosine residue at position 50 that is reportedly sulfated . The recombinant human Otoraplin (rhOTOR) produced in CHO cells is a single non-glycosylated polypeptide chain with a molecular mass of approximately 14-15 kDa as analyzed by reducing SDS-PAGE .

Preparation

Recombinant human Otoraplin is typically produced in Escherichia coli (E. coli) or Chinese Hamster Ovary (CHO) cells. The protein is purified to a high degree, often exceeding 95% purity as analyzed by SDS-PAGE . The endotoxin level is kept below 0.2 EU/μg, determined by the Limulus Amebocyte Lysate (LAL) method .

Applications

Otoraplin is used in various research applications, particularly those related to inner ear development, auditory function, and cartilage formation. Its role in early chondrogenesis makes it a valuable tool for studying the molecular mechanisms underlying these processes .

Storage and Stability

The lyophilized preparation of recombinant human Otoraplin is stable at 2-8°C but should be kept at -20°C for long-term storage. Upon reconstitution, the preparation is most stable at -20°C to -80°C and can be stored for one week at 2-8°C. For maximal stability, it is recommended to apportion the reconstituted preparation into working aliquots and store at -20°C to -80°C, avoiding repeated freeze/thaw cycles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.