Introduction
Noggin, a secreted polypeptide encoded by the NOG gene, plays a crucial role in embryonic development and bone formation. It inhibits signaling proteins in the transforming growth factor-beta (TGF-beta) superfamily, including bone morphogenetic protein-4 (BMP4). Noggin's ability to diffuse efficiently through extracellular matrices allows it to establish morphogenic gradients. This protein exhibits pleiotropic effects throughout development. Initially identified in Xenopus, noggin restored normal dorsal-ventral body axis in embryos with UV-induced ventralization. Mouse knockout studies underscore noggin's involvement in neural tube fusion, joint formation, and other developmental processes. Notably, dominant human NOG mutations are linked to proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1), both characterized by multiple joint fusions. These syndromes map to chromosome 17q22, the same region as NOG. Importantly, all NOG mutations affect evolutionarily conserved amino acid residues. Human noggin shares significant homology with its Xenopus, rat, and mouse counterparts.
Description
Recombinant Mouse Noggin, produced in E. coli, is a non-glycosylated protein with two polypeptide chains linked by disulfide bonds. Each chain comprises 206 amino acids, resulting in a total molecular weight of approximately 46.4 kDa (23.2 kDa per chain).
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2µm filtered solution containing 30% acetonitrile and 0.1% TFA.
Solubility
Before opening, briefly centrifuge the product to collect contents at the bottom. Reconstitute in 10mM HAc to achieve a concentration of 0.1-1.0 mg/ml. For further dilutions, use appropriate buffered solutions.
Stability
Lyophilized Mouse Noggin remains stable at room temperature for 3 weeks. However, it is recommended to store desiccated below -18°C. Upon reconstitution, store Mouse Noggin at 4°C for 2-7 days or below -18°C for future use. For long-term storage, add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
Purity
Determined by SDS-PAGE, purity is greater than 95.0%.
Biological Activity
The ED50, determined by inhibiting BMP-4-induced alkaline phosphatase production in murine ATDC5 cells, is less than 2ng/ml. This translates to a specific activity exceeding 5.0 x 10^5 IU/mg in the presence of 5ng/ml BMP-4.
Synonyms
Noggin, SYM1, SYNS1, NOG.
Amino Acid Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD
PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG
LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF
WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR
CGWIPIQYPIISECKCSC.