MMP 9 Human
Matrix metalloproteinase-9, MMP-9, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Description
The MMP-9 is purified by proprietary chromatographic techniques.
Product Specs
Matrix metalloproteinase-9, MMP-9, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
IVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFP
FIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSA
CTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDG
RLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVN
GIRHLYGP.
Product Science Overview
MMP-9 is synthesized as an inactive proenzyme (proMMP-9) and requires activation to become functional. The activation process involves the cleavage of the propeptide domain, which exposes the active site of the enzyme. This activation can be mediated by various proteases, including Cathepsin K . The active form of MMP-9 has a molecular weight of approximately 93 kDa .
MMP-9 is produced by a variety of cell types, including monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts, and endothelial cells . It is involved in several physiological and pathological processes, such as:
- Tissue Remodeling: MMP-9 plays a significant role in the remodeling of tissues by degrading ECM components. This is essential during processes like wound healing and embryonic development.
- Inflammatory Responses: MMP-9 is involved in the regulation of inflammatory responses by modulating the activity of cytokines and chemokines.
- Tumor Growth and Metastasis: MMP-9 contributes to tumor progression by promoting angiogenesis, cancer cell migration, and metastasis .
Recombinant human MMP-9 is produced using various expression systems, such as Chinese Hamster Ovary (CHO) cells . The recombinant protein is often supplied in a buffered aqueous solution containing Tris-HCl, calcium chloride, sodium chloride, and Brij-35 . It is typically purified to a high degree of purity (>90%) and is used in various research applications, including studies on ECM degradation, cancer biology, and inflammatory diseases .
Recombinant MMP-9 is widely used in biochemical and physiological studies to understand its role in various biological processes. Some of the key applications include:
- Enzyme Activity Assays: Recombinant MMP-9 is used to study its enzymatic activity and substrate specificity. This helps in understanding the mechanisms of ECM degradation and the regulation of MMP-9 activity.
- Drug Development: MMP-9 is a potential target for therapeutic interventions in diseases such as cancer and inflammatory disorders. Recombinant MMP-9 is used in drug screening assays to identify inhibitors that can modulate its activity.
- Structural Studies: The recombinant protein is used in structural biology studies to elucidate the three-dimensional structure of MMP-9 and its interaction with substrates and inhibitors.
