MMP 9 Rabbit

Matrix Metalloproteinase-9 Rabbit Recombinant
Cat. No.
BT8645
Source
Baculovirus system, insect cells.
Synonyms
Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Appearance
Sterile Filtered clear solution.
Purity
Greater than 85.0% as determined by SDS-PAGE.
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707). The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.

Product Specs

Introduction
Matrix metalloproteinases (MMPs) are enzymes that play a crucial role in breaking down the extracellular matrix, which provides structural support to tissues. MMP9, a specific type of MMP, is initially synthesized as an inactive precursor molecule called a zymogen. Upon activation, MMP9 participates in various physiological processes such as inflammation, tissue remodeling, and wound healing. It is also implicated in pathological conditions like cancer progression. MMP9 exerts its effects by cleaving specific proteins in the extracellular matrix.
Description
This product consists of a recombinant MMP-9 protein derived from rabbits. It encompasses the complete amino acid sequence of the secreted protein, along with a C-terminal Myc-His tag for detection and purification purposes. Produced in insect cells, the recombinant MMP-9 exhibits a molecular weight of approximately 95 kDa due to post-translational modifications.
Physical Appearance
The product is a clear solution that has undergone sterile filtration.
Formulation
The MMP-9 protein is provided in a buffer solution containing 50mM Tris, 150mM NaCl, 10% Glycerol at a pH of 7.5. The protein concentration is 0.3mg/ml.
Stability
For short-term storage (up to 4 weeks), the product can be stored at 4°C. For extended storage, freezing at -20°C is recommended. To maintain stability during long-term storage, the addition of a carrier protein like HSA or BSA (0.1%) is advisable. Repeated freezing and thawing should be avoided to prevent protein degradation.
Purity
The purity of the MMP-9 protein is greater than 85%, as assessed by SDS-PAGE analysis.
Synonyms
Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Source
Baculovirus system, insect cells.
Amino Acid Sequence
APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK
HLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLP
RDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHA
FPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTD
GRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACT
TDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYS
SCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVP
ERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWP
ATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNK
LHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQV
WVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVD
SRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVS
FDILHCPEDENLYFQGLEEQKLISEEDLNSAVDHHHHHH.

Product Science Overview

Structure and Function

MMP-9 has a complex structure comprising several domains:

  • Gelatin-binding domain: Consists of three fibronectin type II units.
  • Catalytic domain: Contains the zinc-binding site essential for its enzymatic activity.
  • Proline-rich type V collagen-homologous domain.
  • Hemopexin-like domain.

These domains enable MMP-9 to degrade type IV and V collagens, which are crucial components of the basement membrane and extracellular matrix .

Biological Roles

MMP-9 is produced by various cell types, including monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts, and endothelial cells . It plays significant roles in:

  • Inflammatory responses: MMP-9 is involved in the mobilization of hematopoietic progenitor cells from bone marrow.
  • Tissue remodeling: It contributes to processes such as wound healing and tissue repair.
  • Tumor growth and metastasis: MMP-9 facilitates the invasion and spread of cancer cells by degrading the extracellular matrix .
Clinical Significance

Elevated levels of MMP-9 have been associated with various pathological conditions, including:

  • Idiopathic atrial fibrillation.
  • Aortic aneurysm.
  • Skin carcinogenesis: MMP-9 supplied by bone marrow-derived cells contributes to the development of skin cancer .
Recombinant MMP-9

Recombinant MMP-9, particularly from rabbit sources, is widely used in research to study its structure, function, and role in various diseases. It is produced using advanced expression systems, such as HEK293 cells, to ensure high purity and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.