MMP9 Human, HEK
HEK293 Cells.
Matrix metalloproteinase-9, MMP-9, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Greater than 95.0% as determined by SDS-PAGE.
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
MMP9 Human Recombinant is a single, glycosylated polypeptide chain containing 694 amino acids (20-707a.a) and having a molecular mass of 77.2kDa (calculated). MMP9 is fused to a 6 a.a His tag at C-terminal.
Product Specs
Matrix metalloproteinase-9, MMP-9, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
HEK293 Cells.
APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPET
GELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAF
ALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDD
ELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFG
FCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTR
ADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQ
GYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTT
PQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAE
IGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGAS
VLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHH.
Product Science Overview
Recombinant human MMP-9 is expressed in human embryonic kidney (HEK) 293 cells. This expression system allows for human-like glycosylation and folding, which often supports higher specific activity of the protein . The recombinant MMP-9 is a glycoprotein with a calculated molecular mass of 76 kDa, but it migrates as a ~92 kDa polypeptide on SDS-PAGE due to glycosylation . The protein is produced without artificial tags, ensuring its natural structure and function .
MMP-9 is one of the most complex members of the MMP family in terms of domain structure and regulation of its activity. It can be divided into five distinct domains:
MMP-9 is involved in the degradation of type IV and V collagens, elastin, and gelatin, which are components of the ECM. This degradation is essential for various physiological processes, including:
- Embryonic development: MMP-9 facilitates tissue remodeling and cell migration.
- Reproduction: It plays a role in the breakdown of the ECM during ovulation and implantation.
- Tissue remodeling: MMP-9 is involved in wound healing and the remodeling of tissues .
In pathological conditions, MMP-9 is implicated in:
Studies in rhesus monkeys suggest that MMP-9 is involved in interleukin-8 (IL-8)-induced mobilization of hematopoietic progenitor cells from bone marrow. In murine models, MMP-9 has been shown to play a role in tumor-associated tissue remodeling . Additionally, thrombospondins, intervertebral disc proteins, regulate the effective levels of MMP-2 and MMP-9, which are key effectors of ECM remodeling .
Recombinant human MMP-9 expressed in HEK 293 cells is widely used in research to study its structure, function, and role in various diseases. It is also used as a standard in gelatin zymography, a technique to detect proteolytic activity .
