Lamin-A Human

Lamin-A Human Recombinant
Cat. No.
BT19590
Source
Escherichia Coli.
Synonyms
Prelamin-A/C, LMNA, LMN1, Lamin-A/C, 70 kDa lamin, Renal carcinoma antigen NY-REN-32, FPL, IDC, LFP, CDDC, EMD2, FPLD, HGPS, LDP1, LMNC, PRO1, CDCD1, CMD1A, FPLD2, LMNL1, CMT2B1, LGMD1B.
Appearance
Sterile filtered colorless solution.
Purity
Greater than 90.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Recombinant Human Lamin A produced in E.Coli is a single, non-glycosylated polypeptide chain containing 645 amino acids and having a molecular mass of 70 kDa. Lamin-A protein is fused to a 6xHis tag at N-terminus and purified by conventional chromatography techniques.

Product Specs

Introduction
Lamin-A, a key constituent of the nuclear lamina (a dynamic framework beneath the nuclear envelope), is encoded by the LMNA gene. Synthesized as Prelamin A, this precursor undergoes post-translational modifications to become mature Lamin A. Mutations in the LMNA gene can lead to laminopathies, a group of diseases that includes Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease, and Hutchinson-Gilford progeria syndrome.
Description
Recombinant Human Lamin A, expressed in E. coli, is a single, non-glycosylated polypeptide chain composed of 645 amino acids with a molecular weight of 70 kDa. A 6xHis tag is fused to the N-terminus of the Lamin-A protein, which is purified using standard chromatographic techniques.
Physical Appearance
A clear, sterile-filtered solution.
Formulation
The Lamin-A protein solution (0.9 mg/mL) is formulated in a buffer containing 20 mM phosphate (pH 7.0), 500 mM NaCl, 1 mM DTT, 1.5 mM EDTA, and 20% (v/v) glycerol.
Stability
For short-term storage (2-4 weeks), the product can be stored at 4°C. For long-term storage, freeze the product at -20°C. Repeated freezing and thawing should be avoided.
Purity
Purity is determined to be greater than 90% using SDS-PAGE analysis.
Synonyms
Prelamin-A/C, LMNA, LMN1, Lamin-A/C, 70 kDa lamin, Renal carcinoma antigen NY-REN-32, FPL, IDC, LFP, CDDC, EMD2, FPLD, HGPS, LDP1, LMNC, PRO1, CDCD1, CMD1A, FPLD2, LMNL1, CMT2B1, LGMD1B.
Source
Escherichia Coli.
Amino Acid Sequence

HHHHHH-METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVHSLETENAGLRLRITES
EEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQA
RLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRL
QTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKE
LEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLA
RERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSP
TSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRN
KSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNT
WGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRS
RTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRS


Product Science Overview

Introduction

Lamin-A is a crucial protein that plays a significant role in maintaining the structural integrity of the cell nucleus. It is a type of intermediate filament protein that forms a dense network called the nuclear lamina, located just beneath the inner nuclear membrane. Lamin-A, along with Lamin-C, is encoded by the LMNA gene. These proteins are essential for various cellular functions, including DNA replication, chromatin organization, and cell cycle regulation.

Structure and Function

Lamin-A is synthesized as a precursor protein called prelamin-A, which undergoes several post-translational modifications to become mature Lamin-A. These modifications include farnesylation, proteolytic cleavage, and methylation. The mature Lamin-A protein is approximately 74 kDa in size and is known for its role in providing mechanical support to the nucleus and regulating gene expression.

Recombinant Lamin-A

Human recombinant Lamin-A is produced using recombinant DNA technology, which involves inserting the human LMNA gene into an expression vector and introducing it into a host cell, such as E. coli or yeast. The host cells then produce Lamin-A, which can be purified and used for various research and therapeutic purposes.

Applications

Recombinant Lamin-A is widely used in scientific research to study the functions and interactions of nuclear lamins. It is also used in the development of therapeutic strategies for diseases associated with LMNA mutations, such as Hutchinson-Gilford Progeria Syndrome (HGPS) and various forms of muscular dystrophy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.