IL 19 Mouse

Interleukin-19 Mouse Recombinant
Cat. No.
BT763
Source
Escherichia Coli.
Synonyms
Interleukin-19, IL-19, Il19.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa.
The IL-19 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Interleukin 19 (IL-19) is a cytokine that is part of the IL-10 cytokine family. It is primarily produced by monocytes and signals through the IL-20 receptor complex, leading to the activation of STAT3 (signal transducer and activator of transcription 3). IL-19 is involved in inflammatory responses, as evidenced by studies in mice where a similar cytokine increased the production of IL-6 and TNF-alpha and triggered apoptosis. Multiple isoforms of IL-19 exist due to alternative splicing of the IL-19 transcript.
Description
Recombinant Mouse Interleukin-19, produced in E. coli, is a single, non-glycosylated polypeptide chain. It contains 153 amino acids, resulting in a molecular weight of 17.7 kDa. The purification process involves proprietary chromatographic methods.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a sterile filtered aqueous solution containing 5mM Sodium Phosphate (Na3PO4) and 150mM Sodium Chloride (NaCl), pH 7.5.
Solubility
To reconstitute the lyophilized IL-19, it is recommended to dissolve it in sterile 18M-cm H2O to a concentration of at least 100µg/ml. Further dilutions can be made in other aqueous solutions.
Stability
Lyophilized Interleukin-19, while stable at room temperature for up to 3 weeks, should be stored desiccated below -18°C. After reconstitution, IL19 should be stored at 4°C for no more than 2-7 days. For long-term storage, it is recommended to freeze it below -18°C. The addition of a carrier protein (0.1% HSA or BSA) is recommended for long-term storage. Avoid repeated freeze-thaw cycles.
Purity
Purity is greater than 95.0% as determined by SDS-PAGE analysis.
Synonyms
Interleukin-19, IL-19, Il19.
Source
Escherichia Coli.
Amino Acid Sequence
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL
TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII
HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.

Product Science Overview

Discovery and Structure

IL-19 was first identified in the early 2000s as a novel cytokine with structural similarities to IL-10 . It is produced by various cell types, including monocytes, and has been shown to play a role in the regulation of immune responses. The recombinant form of IL-19, specifically from mice, is often used in research to study its functions and potential therapeutic applications .

Function and Mechanism

IL-19 signals through the IL-20 receptor complex, which is composed of IL-20R1 and IL-20R2 subunits . This signaling pathway is shared with other cytokines in the IL-10 family, such as IL-20 and IL-24. The primary function of IL-19 is to modulate immune responses, particularly in the context of inflammation and infection.

Studies have shown that IL-19 can enhance chronic inflammatory diseases such as asthma . It is produced by and regulates cells of the monocyte lineage, including alveolar macrophages and lung dendritic cells . In vivo studies using IL-19-deficient mice have demonstrated that the absence of IL-19 leads to decreased expression of Major Histocompatibility Complex class II (MHCII) and dysregulation of Notch2 expression in lung monocytes .

Recombinant IL-19

Recombinant mouse IL-19 is produced using E. coli expression systems and is purified to high levels of purity for research purposes . The recombinant protein is often used in cell proliferation assays and other functional studies to understand its role in immune regulation. It is typically lyophilized and reconstituted in sterile phosphate-buffered saline (PBS) for use in experiments .

Applications in Research

IL-19 has been a subject of interest in various research areas, including chronic inflammatory diseases, immune regulation, and potential therapeutic applications. The use of recombinant IL-19 allows researchers to study its effects in controlled settings and to explore its potential as a therapeutic target for conditions such as asthma and other inflammatory diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.