ICAM1 Human HEK

Intercellular Adhesion Molecule-1 Human Recombinant HEK
Cat. No.
BT25036
Source
HEK293 cells.
Synonyms
Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95% as determined by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock

Description

ICAM1 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 461 amino acids (28-480). ICAM1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Product Specs

Introduction
ICAM-1, also known as CD54, is a transmembrane glycoprotein found on various cell types, including those involved in the immune response. It plays a crucial role in cell signaling and adhesion, particularly in the immune system's response to inflammation. ICAM-1 interacts with integrins like CD11a/CD18 and CD11b/CD18, facilitating leukocyte adhesion and transmigration. Additionally, it serves as a receptor for rhinovirus. ICAM-1 expression is upregulated by cytokines like IL-1 and TNFα, leading to increased leukocyte recruitment to sites of inflammation. Its involvement in conditions like subarachnoid hemorrhage highlights its significance in inflammatory processes.
Description
This product consists of the recombinant human ICAM1 protein, produced in a mammalian expression system using human cells. The protein encompasses amino acids 28 to 480 of the ICAM1 sequence, with an 8-amino acid His-tag added to the C-terminus. Purification is achieved through proprietary chromatographic techniques, resulting in a single polypeptide chain.
Physical Appearance
The product appears as a sterile, white powder that has been lyophilized (freeze-dried).
Formulation
The lyophilization of ICAM1 was performed from a 0.2 µM filtered solution containing 20 mM PB (phosphate buffer) and 150 mM NaCl (sodium chloride) at a pH of 7.2.
Solubility
For reconstitution, it is recommended to dissolve the lyophilized ICAM1 in 1x PBS (phosphate-buffered saline) to a minimum concentration of 100 µg/ml. Further dilutions can be made using other aqueous solutions as needed.
Stability
While the lyophilized ICAM1 remains stable at room temperature for up to 3 weeks, it is best stored desiccated at a temperature below -18°C. After reconstitution, the ICAM1 solution should be stored at 4°C for a period of 2 to 7 days. For long-term storage, it is recommended to keep it below -18°C. It is crucial to avoid repeated freeze-thaw cycles to maintain protein integrity.
Purity
The purity of this product is greater than 95%, as determined by SDS-PAGE analysis.
Synonyms
Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58.
Source
HEK293 cells.
Amino Acid Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQE
DSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANL
TVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAP
YQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGN
DSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEV
TVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELR
VLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYL
CRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH.


Product Science Overview

Structure and Function

ICAM-1 is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic domain . The extracellular domain is heavily glycosylated and contains multiple loops created by disulfide bridges, which are essential for its function . The primary role of ICAM-1 is to facilitate the adhesion and transmigration of leukocytes (white blood cells) across the endothelium to sites of inflammation .

Upon cytokine stimulation, the expression of ICAM-1 is significantly upregulated . It binds to integrins, specifically LFA-1 (CD11a/CD18) and Mac-1 (CD11b/CD18), on leukocytes, which allows these cells to adhere to the endothelial cells and migrate into tissues . This process is vital for the immune response, as it enables leukocytes to reach and combat sites of infection or injury .

Role in Inflammatory Diseases

ICAM-1 is a key player in various inflammatory diseases. Its expression is increased in conditions such as ulcerative colitis, rheumatoid arthritis, and neurodegenerative diseases like Parkinson’s disease . In these diseases, ICAM-1 facilitates the recruitment of leukocytes to the affected tissues, contributing to the inflammatory response .

Human Recombinant ICAM-1 (HEK)

Human recombinant ICAM-1 is produced using HEK293 cells, a type of human embryonic kidney cell line . This recombinant protein is used in research to study the function and role of ICAM-1 in various biological processes and diseases . The recombinant ICAM-1 protein expressed in HEK293 cells is typically tagged with a His-tag for easy purification and detection .

Applications in Research

Recombinant ICAM-1 is widely used in research to investigate its role in cell signaling, immune response, and disease mechanisms. It is particularly valuable in studying the interactions between leukocytes and endothelial cells, as well as the molecular pathways involved in inflammation and immune responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.