HCC 1 Human

HCC-1 Human Recombinant (CCL14)
Cat. No.
BT14587
Source
Escherichia Coli.
Synonyms
Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage
THE BioTek's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipped with Ice Packs
In Stock
Quick Inquiry

Description

HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton.
The HCC-1 is purified by proprietary chromatographic techniques.

Product Specs

Introduction
Chemokine (C-C motif) ligand 14, also known as CCL14 or HCC-1, is a small cytokine belonging to the CC chemokine family. CCL14 is produced as a protein precursor that undergoes processing to generate a mature, active protein consisting of 74 amino acids. It shares 46% amino acid similarity with CCL3 and CCL4. CCL14 expression is observed in various tissues, including the spleen, bone marrow, liver, muscle, and gut. This chemokine activates monocytes without inducing their chemotaxis. In humans, the CCL13 gene is located on chromosome 17 within a cluster of other CC chemokine genes.
Description
Recombinant Human HCC-1, produced in E. coli, is a single, non-glycosylated polypeptide chain composed of 72 amino acids, with a molecular weight of 8.4 kDa. HCC-1 is purified using proprietary chromatographic techniques.
Physical Appearance
Sterile filtered white lyophilized powder.
Formulation
The CCL14 protein was lyophilized in a solution containing 20mM PBS (pH 7.4) and 150mM NaCl.
Solubility
Reconstitute the lyophilized HCC-1 in sterile 18 MΩ-cm H2O to a concentration of at least 100 µg/ml. This solution can be further diluted in other aqueous solutions.
Stability
Lyophilized HCC1 is stable at room temperature for up to 3 weeks. However, it is recommended to store the lyophilized protein desiccated at -18°C for long-term storage. After reconstitution, CCL14 should be stored at 4°C for 2-7 days. For long-term storage, aliquot and store at -18°C. Avoid repeated freeze-thaw cycles. For increased stability during storage, consider adding a carrier protein (0.1% HSA or BSA).
Purity
Purity is determined by: (a) RP-HPLC analysis (b) SDS-PAGE analysis. Purity is greater than 97.0%.
Biological Activity
Biological activity is determined by the ability to chemoattract human monocytes. The effective concentration range is 5-20 ng/ml, corresponding to a specific activity of 50,000-200,000 IU/mg.
Synonyms
Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.
Source
Escherichia Coli.
Amino Acid Sequence
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHS
VCTNPSDKWVQDYIKDMKEN.

Product Science Overview

Gene and Protein Structure

The gene encoding CCL14 is located on chromosome 17q11.2 and is part of a cluster of CC cytokine genes . The mature protein has a molecular weight of approximately 7.8 kDa . The amino acid sequence of CCL14 includes four highly conserved residues present in CC chemokines .

Expression and Function

CCL14 is constitutively expressed in multiple tissues, including the spleen, bone marrow, liver, muscle, and gut . It induces changes in intracellular calcium concentration and enzyme release in monocytes . Upon processing of the N-terminal residues by the uPA-plasmin system, the active form of CCL14 acts as a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3 . This active form is also a potent inhibitor of HIV entry .

Biological Activity

CCL14 causes chemotaxis of different types of leukocytes, which is crucial for immune response . Its ability to chemoattract human monocytes has been demonstrated in functional assays, with effective concentrations ranging from 5.0 to 20.0 ng/ml . The active form of CCL14 is particularly significant in immune regulation and inflammatory responses.

Industrial and Research Applications

Recombinant human CCL14 is produced in E. coli and is available for research purposes . It is used in various functional assays to study its role in chemotaxis and immune response. The recombinant protein is typically lyophilized and requires reconstitution before use . It is important to handle and store the protein under specific conditions to maintain its stability and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

Related Products

HCC 1 Human (66 a.a.)
HCC-1 Human Recombinant (CCL14) (66 a.a.)
Cat. No.
BT14650
Source
Escherichia Coli.
HCC 1 Human, His
HCC-1 (CCL14) Human Recombinant, His Tag
Cat. No.
BT14721
Source
Escherichia Coli.
THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2024 Thebiotek. All Rights Reserved.